UniProt ID | DHRSX_HUMAN | |
---|---|---|
UniProt AC | Q8N5I4 | |
Protein Name | Dehydrogenase/reductase SDR family member on chromosome X | |
Gene Name | DHRSX | |
Organism | Homo sapiens (Human). | |
Sequence Length | 330 | |
Subcellular Localization | Secreted . Secreted in a non-classical form. A signal peptide sequence at position 1-31 is predicted. | |
Protein Description | Involved in the positive regulation of starvation-induced autophagy. [PubMed: 25076851] | |
Protein Sequence | MSPLSAARAALRVYAVGAAVILAQLLRRCRGGFLEPVFPPRPDRVAIVTGGTDGIGYSTAKHLARLGMHVIIAGNNDSKAKQVVSKIKEETLNDKVEFLYCDLASMTSIRQFVQKFKMKKIPLHVLINNAGVMMVPQRKTRDGFEEHFGLNYLGHFLLTNLLLDTLKESGSPGHSARVVTVSSATHYVAELNMDDLQSSACYSPHAAYAQSKLALVLFTYHLQRLLAAEGSHVTANVVDPGVVNTDVYKHVFWATRLAKKLLGWLLFKTPDEGAWTSIYAAVTPELEGVGGHYLYNEKETKSLHVTYNQKLQQQLWSKSCEMTGVLDVTL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Phosphorylation | ------MSPLSAARA ------CCHHHHHHH | 34.25 | 29514088 | |
5 | Phosphorylation | ---MSPLSAARAALR ---CCHHHHHHHHHH | 24.22 | 29514088 | |
61 | Ubiquitination | GIGYSTAKHLARLGM CCCHHHHHHHHHCCC | 38.96 | - | |
260 | Ubiquitination | WATRLAKKLLGWLLF HHHHHHHHHHHHHHC | 43.25 | 33845483 | |
302 | Phosphorylation | YNEKETKSLHVTYNQ CCCCCCEEEEEEHHH | 31.00 | 28857561 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of DHRSX_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of DHRSX_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of DHRSX_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
A4_HUMAN | APP | physical | 21832049 | |
GCNT3_HUMAN | GCNT3 | physical | 21988832 | |
ZBED1_HUMAN | ZBED1 | physical | 26186194 | |
ZBED1_HUMAN | ZBED1 | physical | 28514442 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...