| UniProt ID | DHRSX_HUMAN | |
|---|---|---|
| UniProt AC | Q8N5I4 | |
| Protein Name | Dehydrogenase/reductase SDR family member on chromosome X | |
| Gene Name | DHRSX | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 330 | |
| Subcellular Localization | Secreted . Secreted in a non-classical form. A signal peptide sequence at position 1-31 is predicted. | |
| Protein Description | Involved in the positive regulation of starvation-induced autophagy. [PubMed: 25076851] | |
| Protein Sequence | MSPLSAARAALRVYAVGAAVILAQLLRRCRGGFLEPVFPPRPDRVAIVTGGTDGIGYSTAKHLARLGMHVIIAGNNDSKAKQVVSKIKEETLNDKVEFLYCDLASMTSIRQFVQKFKMKKIPLHVLINNAGVMMVPQRKTRDGFEEHFGLNYLGHFLLTNLLLDTLKESGSPGHSARVVTVSSATHYVAELNMDDLQSSACYSPHAAYAQSKLALVLFTYHLQRLLAAEGSHVTANVVDPGVVNTDVYKHVFWATRLAKKLLGWLLFKTPDEGAWTSIYAAVTPELEGVGGHYLYNEKETKSLHVTYNQKLQQQLWSKSCEMTGVLDVTL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Phosphorylation | ------MSPLSAARA ------CCHHHHHHH | 34.25 | 29514088 | |
| 5 | Phosphorylation | ---MSPLSAARAALR ---CCHHHHHHHHHH | 24.22 | 29514088 | |
| 61 | Ubiquitination | GIGYSTAKHLARLGM CCCHHHHHHHHHCCC | 38.96 | - | |
| 260 | Ubiquitination | WATRLAKKLLGWLLF HHHHHHHHHHHHHHC | 43.25 | 33845483 | |
| 302 | Phosphorylation | YNEKETKSLHVTYNQ CCCCCCEEEEEEHHH | 31.00 | 28857561 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of DHRSX_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of DHRSX_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of DHRSX_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| A4_HUMAN | APP | physical | 21832049 | |
| GCNT3_HUMAN | GCNT3 | physical | 21988832 | |
| ZBED1_HUMAN | ZBED1 | physical | 26186194 | |
| ZBED1_HUMAN | ZBED1 | physical | 28514442 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...