| UniProt ID | DEFB1_HUMAN | |
|---|---|---|
| UniProt AC | P60022 | |
| Protein Name | Beta-defensin 1 | |
| Gene Name | DEFB1 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 68 | |
| Subcellular Localization | Secreted . Membrane . Associates with tumor cell membrane-derived microvesicles (PubMed:23938203). | |
| Protein Description | Has bactericidal activity. May act as a ligand for C-C chemokine receptor CCR6. Positively regulates the sperm motility and bactericidal activity in a CCR6-dependent manner. Binds to CCR6 and triggers Ca2+ mobilization in the sperm which is important for its motility. [PubMed: 25122636] | |
| Protein Sequence | MRTSYLLLFTLCLLLSEMASGGNFLTGLGHRSDHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 4 | Phosphorylation | ----MRTSYLLLFTL ----CCHHHHHHHHH | 11.92 | 26074081 | |
| 5 | Phosphorylation | ---MRTSYLLLFTLC ---CCHHHHHHHHHH | 10.76 | 26074081 | |
| 10 | Phosphorylation | TSYLLLFTLCLLLSE HHHHHHHHHHHHHHH | 19.28 | 26074081 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of DEFB1_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of DEFB1_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of DEFB1_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| FBXW5_HUMAN | FBXW5 | physical | 28514442 | |
| F172A_HUMAN | FAM172A | physical | 28514442 | |
| P20D2_HUMAN | PM20D2 | physical | 28514442 | |
| NMT2_HUMAN | NMT2 | physical | 28514442 | |
| NMT1_HUMAN | NMT1 | physical | 28514442 | |
| MPPA_HUMAN | PMPCA | physical | 28514442 | |
| MPPB_HUMAN | PMPCB | physical | 28514442 | |
| IDE_HUMAN | IDE | physical | 28514442 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
