UniProt ID | DEFB1_HUMAN | |
---|---|---|
UniProt AC | P60022 | |
Protein Name | Beta-defensin 1 | |
Gene Name | DEFB1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 68 | |
Subcellular Localization | Secreted . Membrane . Associates with tumor cell membrane-derived microvesicles (PubMed:23938203). | |
Protein Description | Has bactericidal activity. May act as a ligand for C-C chemokine receptor CCR6. Positively regulates the sperm motility and bactericidal activity in a CCR6-dependent manner. Binds to CCR6 and triggers Ca2+ mobilization in the sperm which is important for its motility. [PubMed: 25122636] | |
Protein Sequence | MRTSYLLLFTLCLLLSEMASGGNFLTGLGHRSDHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
4 | Phosphorylation | ----MRTSYLLLFTL ----CCHHHHHHHHH | 11.92 | 26074081 | |
5 | Phosphorylation | ---MRTSYLLLFTLC ---CCHHHHHHHHHH | 10.76 | 26074081 | |
10 | Phosphorylation | TSYLLLFTLCLLLSE HHHHHHHHHHHHHHH | 19.28 | 26074081 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of DEFB1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of DEFB1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of DEFB1_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
FBXW5_HUMAN | FBXW5 | physical | 28514442 | |
F172A_HUMAN | FAM172A | physical | 28514442 | |
P20D2_HUMAN | PM20D2 | physical | 28514442 | |
NMT2_HUMAN | NMT2 | physical | 28514442 | |
NMT1_HUMAN | NMT1 | physical | 28514442 | |
MPPA_HUMAN | PMPCA | physical | 28514442 | |
MPPB_HUMAN | PMPCB | physical | 28514442 | |
IDE_HUMAN | IDE | physical | 28514442 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...