UniProt ID | CPNS2_HUMAN | |
---|---|---|
UniProt AC | Q96L46 | |
Protein Name | Calpain small subunit 2 | |
Gene Name | CAPNS2 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 248 | |
Subcellular Localization | Cytoplasm. Cell membrane. Translocates to the plasma membrane upon calcium binding.. | |
Protein Description | Calcium-regulated non-lysosomal thiol-protease which catalyzes limited proteolysis of substrates involved in cytoskeletal remodeling and signal transduction. This small subunit may act as a tissue-specific chaperone of the large subunit, possibly by helping it fold into its correct conformation for activity.. | |
Protein Sequence | MFLAKALLEGADRGLGEALGGLFGGGGQRREGGGRNIGGIVGGIVNFISEAAAAQYTPEPPPTQQHFTSVEASESEEVRRFRQQFTQLAGPDMEVGATDLMNILNKVLSKHKDLKTDGFSLDTCRSIVSVMDSDTTGKLGFEEFKYLWNNIKKWQCVYKQYDRDHSGSLGSSQLRGALQAAGFQLNEQLYQMIVRRYANEDGDMDFNNFISCLVRLDAMFRAFKSLDRDRDGLIQVSIKEWLQLTMYS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
1 | Acetylation | -------MFLAKALL -------CHHHHHHH | 5.84 | - | |
86 | Phosphorylation | RRFRQQFTQLAGPDM HHHHHHHHHHHCCCC | 20.52 | 32142685 | |
98 | Phosphorylation | PDMEVGATDLMNILN CCCCCCHHHHHHHHH | 24.60 | 29978859 | |
136 | Phosphorylation | SVMDSDTTGKLGFEE HHHCCCCCCCCCHHH | 36.99 | - | |
145 | Ubiquitination | KLGFEEFKYLWNNIK CCCHHHHHHHHHHHH | 42.59 | - | |
159 | Acetylation | KKWQCVYKQYDRDHS HHHHHEEEECCCCCC | 23.22 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CPNS2_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CPNS2_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CPNS2_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
A4_HUMAN | APP | physical | 21832049 | |
ACTA_HUMAN | ACTA2 | physical | 26186194 | |
CPNS1_HUMAN | CAPNS1 | physical | 26186194 | |
CAN1_HUMAN | CAPN1 | physical | 26186194 | |
ICAL_HUMAN | CAST | physical | 26186194 | |
LIX1L_HUMAN | LIX1L | physical | 26186194 | |
LIX1L_HUMAN | LIX1L | physical | 28514442 | |
ICAL_HUMAN | CAST | physical | 28514442 | |
ACTA_HUMAN | ACTA2 | physical | 28514442 | |
CPNS1_HUMAN | CAPNS1 | physical | 28514442 | |
ACTBL_HUMAN | ACTBL2 | physical | 28514442 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...