dbPTM

COPT2_HUMAN - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	COPT2_HUMAN
UniProt AC	O15432
Protein Name	Probable low affinity copper uptake protein 2
Gene Name	SLC31A2
Organism	Homo sapiens (Human).
Sequence Length	143
Subcellular Localization	Membrane Multi-pass membrane protein .
Protein Description	Involved in low-affinity copper uptake..
Protein Sequence	MAMHFIFSDTAVLLFDFWSVHSPAGMALSVLVLLLLAVLYEGIKVGKAKLLNQVLVNLPTSISQQTIAETDGDSAGSDSFPVGRTHHRWYLCHFGQSLIHVIQVVIGYFIMLAVMSYNTWIFLGVVLGSAVGYYLAYPLLSTA

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
60	Phosphorylation	QVLVNLPTSISQQTI HHHHHCCCCHHHHHH	41.69	20873877
61	Phosphorylation	VLVNLPTSISQQTIA HHHHCCCCHHHHHHC	20.50	20873877
63	Phosphorylation	VNLPTSISQQTIAET HHCCCCHHHHHHCCC	18.92	20873877
66	Phosphorylation	PTSISQQTIAETDGD CCCHHHHHHCCCCCC	17.95	26657352
70	Phosphorylation	SQQTIAETDGDSAGS HHHHHCCCCCCCCCC	35.94	20873877
74	Phosphorylation	IAETDGDSAGSDSFP HCCCCCCCCCCCCCC	39.81	20873877
77	Phosphorylation	TDGDSAGSDSFPVGR CCCCCCCCCCCCCCC	29.78	20873877
79	Phosphorylation	GDSAGSDSFPVGRTH CCCCCCCCCCCCCCC	32.90	20873877

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of COPT2_HUMAN !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of COPT2_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of COPT2_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
RAMP1_HUMAN	RAMP1	physical	14722252
RAMP2_HUMAN	RAMP2	physical	14722252
RAMP3_HUMAN	RAMP3	physical	14722252

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of COPT2_HUMAN

Related Literatures of Post-Translational Modification