UniProt ID | RAMP1_HUMAN | |
---|---|---|
UniProt AC | O60894 | |
Protein Name | Receptor activity-modifying protein 1 | |
Gene Name | RAMP1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 148 | |
Subcellular Localization |
Membrane Single-pass type I membrane protein. |
|
Protein Description | Transports the calcitonin gene-related peptide type 1 receptor (CALCRL) to the plasma membrane. Acts as a receptor for calcitonin-gene-related peptide (CGRP) together with CALCRL.. | |
Protein Sequence | MARALCRLPRRGLWLLLAHHLFMTTACQEANYGALLRELCLTQFQVDMEAVGETLWCDWGRTIRSYRELADCTWHMAEKLGCFWPNAEVDRFFLAVHGRYFRSCPISGRAVRDPPGSILYPFIVVPITVTLLVTALVVWQSKRTEGIV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
100 | Phosphorylation | FLAVHGRYFRSCPIS EEHHHCCEEECCCCC | 14.13 | 28509920 | |
103 | Phosphorylation | VHGRYFRSCPISGRA HHCCEEECCCCCCCC | 17.85 | - | |
107 | Phosphorylation | YFRSCPISGRAVRDP EEECCCCCCCCCCCC | 13.84 | 27251275 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RAMP1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RAMP1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RAMP1_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
CALRL_HUMAN | CALCRL | physical | 11535606 | |
RAMP1_HUMAN | RAMP1 | physical | 11535606 | |
RAMP1_HUMAN | RAMP1 | physical | 9620797 | |
CALRL_HUMAN | CALCRL | physical | 12684503 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...