UniProt ID | CLIC4_RAT | |
---|---|---|
UniProt AC | Q9Z0W7 | |
Protein Name | Chloride intracellular channel protein 4 | |
Gene Name | Clic4 | |
Organism | Rattus norvegicus (Rat). | |
Sequence Length | 253 | |
Subcellular Localization |
Endoplasmic reticulum. Membrane Single-pass membrane protein . Cytoplasm. Cytoplasmic vesicle membrane Single-pass membrane protein. Nucleus. Cell membrane Single-pass membrane protein. Exists both as soluble cytoplasmic protein and as membrane p |
|
Protein Description | Can insert into membranes and form poorly selective ion channels that may also transport chloride ions. Channel activity depends on the pH. Membrane insertion seems to be redox-regulated and may occur only under oxydizing conditions. Promotes cell-surface expression of HRH3. May play a role in angiogenesis (By similarity).. | |
Protein Sequence | MALSMPLNGLKEEDKEPLIELFVKAGSDGESIGNCPFSQRLFMILWLKGVVFSVTTVDLKRKPAHLQNLAPGTHPPFITFNSEVKTDVNKIEEFLEEVLCPPKYLKLSPKHPESNTAGMDIFAKFSAYIKNSRPEANEALERGLLKTLQKLDEYLNSPLPGEIDENSMEDIKSSTRRFLDGDEMTLADCNLLPKLHIVKVVAKKYRNFDIPKGMTGIWRYLTNAYSRDEFTNTCPSDKEVEIAYSDVAKRLTK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MALSMPLNG ------CCCCCCCCC | 14.35 | - | |
4 | Phosphorylation | ----MALSMPLNGLK ----CCCCCCCCCCC | 14.60 | 27097102 | |
24 | Acetylation | PLIELFVKAGSDGES HHHHHHHHCCCCCCC | 39.43 | - | |
106 | Acetylation | LCPPKYLKLSPKHPE CCCHHHCCCCCCCCC | 43.77 | 22902405 | |
128 | Phosphorylation | IFAKFSAYIKNSRPE HHHHHHHHHHCCCHH | 15.95 | 25575281 | |
130 | Acetylation | AKFSAYIKNSRPEAN HHHHHHHHCCCHHHH | 35.87 | 22902405 | |
132 | Phosphorylation | FSAYIKNSRPEANEA HHHHHHCCCHHHHHH | 44.18 | 25575281 | |
146 | Acetylation | ALERGLLKTLQKLDE HHHHHHHHHHHHHHH | 52.83 | 22902405 | |
157 | Phosphorylation | KLDEYLNSPLPGEID HHHHHHCCCCCCCCC | 25.81 | 21373199 | |
167 | Phosphorylation | PGEIDENSMEDIKSS CCCCCCCCHHHHHHH | 22.85 | - | |
199 | Acetylation | LPKLHIVKVVAKKYR CCCCCHHHHHHHHHC | 30.32 | 22902405 | |
199 | Ubiquitination | LPKLHIVKVVAKKYR CCCCCHHHHHHHHHC | 30.32 | - | |
212 | Acetylation | YRNFDIPKGMTGIWR HCCCCCCCCCHHHHH | 62.74 | 22902405 | |
233 | Phosphorylation | SRDEFTNTCPSDKEV CCCCCCCCCCCCCCE | 23.80 | 30181290 | |
236 | Phosphorylation | EFTNTCPSDKEVEIA CCCCCCCCCCCEEEE | 64.56 | 30181290 | |
244 | Phosphorylation | DKEVEIAYSDVAKRL CCCEEEEHHHHHHHH | 15.86 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CLIC4_RAT !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CLIC4_RAT !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CLIC4_RAT !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...