UniProt ID | CLIC3_HUMAN | |
---|---|---|
UniProt AC | O95833 | |
Protein Name | Chloride intracellular channel protein 3 | |
Gene Name | CLIC3 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 236 | |
Subcellular Localization |
Nucleus. Membrane Single-pass membrane protein. Cytoplasm. Predominantly nuclear. Some protein was found in the cytoplasm. Exists both as soluble cytoplasmic protein and as membrane protein with probably a single transmembrane domain (By similarity) |
|
Protein Description | Can insert into membranes and form chloride ion channels. May participate in cellular growth control.. | |
Protein Sequence | MAETKLQLFVKASEDGESVGHCPSCQRLFMVLLLKGVPFTLTTVDTRRSPDVLKDFAPGSQLPILLYDSDAKTDTLQIEDFLEETLGPPDFPSLAPRYRESNTAGNDVFHKFSAFIKNPVPAQDEALYQQLLRALARLDSYLRAPLEHELAGEPQLRESRRRFLDGDRLTLADCSLLPKLHIVDTVCAHFRQAPIPAELRGVRRYLDSAMQEKEFKYTCPHSAEILAAYRPAVHPR | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
40 | Phosphorylation | LLKGVPFTLTTVDTR HHCCCCEEEEECCCC | 19.68 | 27251275 | |
42 | Phosphorylation | KGVPFTLTTVDTRRS CCCCEEEEECCCCCC | 23.01 | 23090842 | |
43 | Phosphorylation | GVPFTLTTVDTRRSP CCCEEEEECCCCCCC | 21.35 | 23090842 | |
46 | Phosphorylation | FTLTTVDTRRSPDVL EEEEECCCCCCCCHH | 24.52 | 23090842 | |
49 | Phosphorylation | TTVDTRRSPDVLKDF EECCCCCCCCHHHHC | 23.35 | 30278072 | |
54 | Ubiquitination | RRSPDVLKDFAPGSQ CCCCCHHHHCCCCCC | 51.12 | - | |
93 | Phosphorylation | LGPPDFPSLAPRYRE HCCCCCCCCCHHHHH | 36.84 | 24719451 | |
128 | Phosphorylation | PAQDEALYQQLLRAL CCCCHHHHHHHHHHH | 10.97 | - | |
159 | Phosphorylation | GEPQLRESRRRFLDG CCCCHHHHHHHHCCC | 25.34 | 20146363 | |
175 | Phosphorylation | RLTLADCSLLPKLHI CEEHHHHHHHCCCEE | 33.22 | 24905233 | |
205 | Phosphorylation | ELRGVRRYLDSAMQE HHHHHHHHHHHHHHH | 12.33 | 28348404 | |
208 | Phosphorylation | GVRRYLDSAMQEKEF HHHHHHHHHHHHHCC | 24.05 | 22985185 | |
229 | Phosphorylation | SAEILAAYRPAVHPR HHHHHHHHCCCCCCC | 16.12 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CLIC3_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CLIC3_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CLIC3_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
A4_HUMAN | APP | physical | 21832049 | |
EFHC2_HUMAN | EFHC2 | physical | 25416956 | |
SPS2_HUMAN | SEPHS2 | physical | 26344197 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...