CLD8_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CLD8_HUMAN
• UniProt AC: P56748
• Protein Name: Claudin-8
• Gene Name: CLDN8 {ECO:0000312|HGNC:HGNC:2050}
• Organism: Homo sapiens (Human).
• Sequence Length: 225
• Subcellular Localization: Cell junction, tight junction . Cell membrane ; Multi-pass membrane protein . Localizes to tight junctions in all 3 segments of the epididymis, in the caput found in the lateral margins of principal cells, and in the corpus at the interface between b
• Protein Description: Tight-junction protein required for paracellular chloride transport in the kidney. Mediates recruitment of CLDN4 to tight junction in the kidney. Claudins play a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity..
• Protein Sequence: MATHALEIAGLFLGGVGMVGTVAVTVMPQWRVSAFIENNIVVFENFWEGLWMNCVRQANIRMQCKIYDSLLALSPDLQAARGLMCAASVMSFLAFMMAILGMKCTRCTGDNEKVKAHILLTAGIIFIITGMVVLIPVSWVANAIIRDFYNSIVNVAQKRELGEALYLGWTTALVLIVGGALFCCVFCCNEKSSSYRYSIPSHRTTQKSYHTGKKSPSVYSRSQYV

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
67	Phosphorylation	IRMQCKIYDSLLALS HHHHCHHHHHHHHHC	5.74	22817900
69	Phosphorylation	MQCKIYDSLLALSPD HHCHHHHHHHHHCCC	14.33	22817900
74	Phosphorylation	YDSLLALSPDLQAAR HHHHHHHCCCHHHHH	15.68	22817900
197	Phosphorylation	EKSSSYRYSIPSHRT CCCCCCCCCCCCCCC	11.61	24719451
198	Phosphorylation	KSSSYRYSIPSHRTT CCCCCCCCCCCCCCC	21.01	24719451
204	Phosphorylation	YSIPSHRTTQKSYHT CCCCCCCCCCCCCCC	28.31	27251275
205	Phosphorylation	SIPSHRTTQKSYHTG CCCCCCCCCCCCCCC	33.68	27251275
208	Phosphorylation	SHRTTQKSYHTGKKS CCCCCCCCCCCCCCC	16.60	27251275
211	Phosphorylation	TTQKSYHTGKKSPSV CCCCCCCCCCCCCCC	42.33	29759185
215	Phosphorylation	SYHTGKKSPSVYSRS CCCCCCCCCCCCCCC	26.37	27251275
217	Phosphorylation	HTGKKSPSVYSRSQY CCCCCCCCCCCCCCC	40.55	22617229
220	Phosphorylation	KKSPSVYSRSQYV-- CCCCCCCCCCCCC--	24.25	22617229
222	Phosphorylation	SPSVYSRSQYV---- CCCCCCCCCCC----	21.66	25056879

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of CLD8_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of CLD8_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CLD8_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
ZO1_HUMAN	TJP1	physical	10601346
KASH5_HUMAN	CCDC155	physical	25416956
SYNE4_HUMAN	SYNE4	physical	25416956
KLHL3_HUMAN	KLHL3	physical	25831548

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.