CKS1_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CKS1_SCHPO
• UniProt AC: P08463
• Protein Name: Cyclin-dependent kinases regulatory subunit
• Gene Name: suc1
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 113
• Protein Description: Binds to the catalytic subunit of the cyclin dependent kinase (cdc2) and is essential for its biological function..
• Protein Sequence: MSKSGVPRLLTASERERLEPFIDQIHYSPRYADDEYEYRHVMLPKAMLKAIPTDYFNPETGTLRILQEEEWRGLGITQSLGWEMYEVHVPEPHILLFKREKDYQMKFSQQRGG

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of CKS1_SCHPO !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of CKS1_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of CKS1_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CKS1_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
CDK1_SCHPO	cdc2	physical	9790601
CDK1_SCHPO	cdc2	physical	3322810
CKS1_SCHPO	suc1	physical	8805536
GAR1_SCHPO	gar1	physical	9211981
ESP1_YEAST	ESP1	physical	21518961
CDK1_YEAST	CDC28	physical	21518961
RPB1_YEAST	RPO21	physical	22689984
CDK1_YEAST	CDC28	physical	22689984
CDK1_SCHPO	cdc2	physical	2569363
CDK1_YEAST	CDC28	physical	24374311
SRL3_YEAST	SRL3	physical	24374311

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.