CIDEB_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CIDEB_HUMAN
• UniProt AC: Q9UHD4
• Protein Name: Cell death activator CIDE-B
• Gene Name: CIDEB
• Organism: Homo sapiens (Human).
• Sequence Length: 219
• Protein Description: Activates apoptosis..
• Protein Sequence: MEYLSALNPSDLLRSVSNISSEFGRRVWTSAPPPQRPFRVCDHKRTIRKGLTAATRQELLAKALETLLLNGVLTLVLEEDGTAVDSEDFFQLLEDDTCLMVLQSGQSWSPTRSGVLSYGLGRERPKHSKDIARFTFDVYKQNPRDLFGSLNVKATFYGLYSMSCDFQGLGPKKVLRELLRWTSTLLQGLGHMLLGISSTLRHAVEGAEQWQQKGRLHSY

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
3	Phosphorylation	-----MEYLSALNPS -----CCCHHCCCHH	12.50	27642862
5	Phosphorylation	---MEYLSALNPSDL ---CCCHHCCCHHHH	29.79	25690035
17	Phosphorylation	SDLLRSVSNISSEFG HHHHHHHHCCCHHHH	29.68	28857561
20	Phosphorylation	LRSVSNISSEFGRRV HHHHHCCCHHHHHCC	28.24	-
109	Phosphorylation	LQSGQSWSPTRSGVL ECCCCCCCCCCCCCH	22.95	29496963
113	Phosphorylation	QSWSPTRSGVLSYGL CCCCCCCCCCHHCCC	35.41	23403867
117	Phosphorylation	PTRSGVLSYGLGRER CCCCCCHHCCCCCCC	18.10	23403867
118	Phosphorylation	TRSGVLSYGLGRERP CCCCCHHCCCCCCCC	16.53	23403867
198	Phosphorylation	HMLLGISSTLRHAVE HHHHHHHHHHHHHHH	29.55	23403867
199	Phosphorylation	MLLGISSTLRHAVEG HHHHHHHHHHHHHHH	22.48	23403867

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of CIDEB_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of CIDEB_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CIDEB_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
DFFB_HUMAN	DFFB	physical	10619428
DFFA_HUMAN	DFFA	physical	10619428
CIDEB_HUMAN	CIDEB	physical	10837461
MB12A_HUMAN	MVB12A	physical	26186194
MB12A_HUMAN	MVB12A	physical	28514442

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.