CHP2_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CHP2_HUMAN
• UniProt AC: O43745
• Protein Name: Calcineurin B homologous protein 2
• Gene Name: CHP2
• Organism: Homo sapiens (Human).
• Sequence Length: 196
• Subcellular Localization: Nucleus . Cytoplasm . Cell membrane . Predominantly localized in a juxtanuclear region. Colocalizes with SLC9A3 in the juxtanuclear region and at the plasma membrane (By similarity). Exported from the nucleus to the cytoplasm through a nuclear export
• Protein Description: Functions as an integral cofactor in cell pH regulation by controlling plasma membrane-type Na(+)/H(+) exchange activity. Binds to and activates SLC9A1/NHE1 in a serum-independent manner, thus increasing pH and protecting cells from serum deprivation-induced death. Also plays a role in the regulation of cell proliferation and tumor growth by increasing the phosphatase activity of PPP3CA in a calcium-dependent manner. Activator of the calcineurin/NFAT signaling pathway. Involved in the cytoplasmic translocation of the transcription factor NFATC3 to the nucleus..
• Protein Sequence: MGSRSSHAAVIPDGDSIRRETGFSQASLLRLHHRFRALDRNKKGYLSRMDLQQIGALAVNPLGDRIIESFFPDGSQRVDFPGFVRVLAHFRPVEDEDTETQDPKKPEPLNSRRNKLHYAFQLYDLDRDGKISRHEMLQVLRLMVGVQVTEEQLENIADRTVQEADEDGDGAVSFVEFTKSLEKMDVEQKMSIRILK

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Myristoylation	------MGSRSSHAA ------CCCCCCCCE	31.59	-
5	Phosphorylation	---MGSRSSHAAVIP ---CCCCCCCCEECC	28.33	23312004
6	Phosphorylation	--MGSRSSHAAVIPD --CCCCCCCCEECCC	18.94	23312004
16	Phosphorylation	AVIPDGDSIRRETGF EECCCCHHHHHHCCC	24.43	23312004
27	Phosphorylation	ETGFSQASLLRLHHR HCCCCHHHHHHHHHH	21.94	23312004
98	Phosphorylation	RPVEDEDTETQDPKK CCCCCCCCCCCCCCC	38.59	23312004
100	Phosphorylation	VEDEDTETQDPKKPE CCCCCCCCCCCCCCC	40.12	23312004
118	Phosphorylation	SRRNKLHYAFQLYDL CHHHCCEEEEEHHCC	21.39	-
123	Phosphorylation	LHYAFQLYDLDRDGK CEEEEEHHCCCCCCC	12.04	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of CHP2_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of CHP2_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CHP2_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
SL9A1_HUMAN	SLC9A1	physical	12576672
SL9A2_HUMAN	SLC9A2	physical	12576672
SL9A3_HUMAN	SLC9A3	physical	12576672
SL9A4_HUMAN	SLC9A4	physical	12576672
SL9A5_HUMAN	SLC9A5	physical	12576672

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.