dbPTM

CDX1_MOUSE - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	CDX1_MOUSE
UniProt AC	P18111
Protein Name	Homeobox protein CDX-1
Gene Name	Cdx1
Organism	Mus musculus (Mouse).
Sequence Length	268
Subcellular Localization	Nucleus.
Protein Description	Plays a role in transcriptional regulation. Involved in activated KRAS-mediated transcriptional activation of PRKD1 in colorectal cancer (CRC) cells. Binds to the PRKD1 promoter in colorectal cancer (CRC) cells. Could play a role in the terminal differentiation of the intestine. Binds preferentially to methylated DNA..
Protein Sequence	MYVGYVLDKDSPVYPGPARPSSLGLGPPTYAPPGPAPAPPQYPDFAGYTHVEPAPAPPPTWAAPFPAPKDDWAAAYGPGPTASAASPAPLAFGPPPDFSPVPAPPGPGPGILAQSLGAPGAPSSPGAPRRTPYEWMRRSVAAAGGGGSGKTRTKDKYRVVYTDHQRLELEKEFHYSRYITIRRKSELAANLGLTERQVKIWFQNRRAKERKVNKKKQQQQQPLPPTQLPLPLDGTPTPSGPPLGSLCPTNAGLLGTPSPVPVKEEFLP

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of CDX1_MOUSE !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of CDX1_MOUSE !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of CDX1_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of CDX1_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
DLX1_MOUSE	Dlx1	physical	20211142
NKX23_MOUSE	Nkx2-3	physical	20211142
T2EA_MOUSE	Gtf2e1	physical	20211142
ZFP82_MOUSE	Zfp82	physical	20211142
WNT3_MOUSE	Wnt3	genetic	15143193

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of CDX1_MOUSE

Related Literatures of Post-Translational Modification