UniProt ID | CD7_HUMAN | |
---|---|---|
UniProt AC | P09564 | |
Protein Name | T-cell antigen CD7 | |
Gene Name | CD7 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 240 | |
Subcellular Localization |
Membrane Single-pass type I membrane protein. |
|
Protein Description | Not yet known.. | |
Protein Sequence | MAGPPRLLLLPLLLALARGLPGALAAQEVQQSPHCTTVPVGASVNITCSTSGGLRGIYLRQLGPQPQDIIYYEDGVVPTTDRRFRGRIDFSGSQDNLTITMHRLQLSDTGTYTCQAITEVNVYGSGTLVLVTEEQSQGWHRCSDAPPRASALPAPPTGSALPDPQTASALPDPPAASALPAALAVISFLLGLGLGVACVLARTQIKKLCSWRDKNSAACVVYEDMSHSRCNTLSSPNQYQ | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
45 | N-linked_Glycosylation | VPVGASVNITCSTSG ECCCCEEEEEEECCC | 22.74 | UniProtKB CARBOHYD | |
96 | N-linked_Glycosylation | DFSGSQDNLTITMHR CCCCCCCCEEEEEEE | 31.29 | 19159218 | |
96 | N-linked_Glycosylation | DFSGSQDNLTITMHR CCCCCCCCEEEEEEE | 31.29 | 19349973 | |
198 | S-palmitoylation | GLGLGVACVLARTQI HHHHHHHHHHHHHHH | 2.09 | 3501369 | |
214 | Methylation | KLCSWRDKNSAACVV HHHCCCCCCCEEEEE | 44.20 | 23644510 | |
214 | Ubiquitination | KLCSWRDKNSAACVV HHHCCCCCCCEEEEE | 44.20 | - | |
215 | N-linked_Glycosylation | LCSWRDKNSAACVVY HHCCCCCCCEEEEEE | 40.96 | - | |
215 | N-linked_Glycosylation | LCSWRDKNSAACVVY HHCCCCCCCEEEEEE | 40.96 | 19349973 | |
216 | Phosphorylation | CSWRDKNSAACVVYE HCCCCCCCEEEEEEE | 24.00 | 28796482 | |
222 | Phosphorylation | NSAACVVYEDMSHSR CCEEEEEEECCCCCC | 5.94 | 19605366 | |
226 | Phosphorylation | CVVYEDMSHSRCNTL EEEEECCCCCCCCCC | 30.54 | 23401153 | |
228 | Phosphorylation | VYEDMSHSRCNTLSS EEECCCCCCCCCCCC | 31.08 | 23401153 | |
232 | Phosphorylation | MSHSRCNTLSSPNQY CCCCCCCCCCCCCCC | 31.48 | 30576142 | |
234 | Phosphorylation | HSRCNTLSSPNQYQ- CCCCCCCCCCCCCC- | 41.53 | 26552605 | |
235 | Phosphorylation | SRCNTLSSPNQYQ-- CCCCCCCCCCCCC-- | 30.86 | 29978859 | |
239 | Phosphorylation | TLSSPNQYQ------ CCCCCCCCC------ | 23.88 | 28796482 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CD7_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CD7_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CD7_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
P85A_HUMAN | PIK3R1 | physical | 12594831 | |
P4K2A_HUMAN | PI4K2A | physical | 12594831 | |
IKBA_HUMAN | NFKBIA | physical | 21988832 | |
CPTP_HUMAN | CPTP | physical | 21988832 | |
PTH2_HUMAN | PTRH2 | physical | 28514442 | |
MYADM_HUMAN | MYADM | physical | 28514442 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
H00002 | Acute lymphoblastic leukemia (ALL) (precursor T lymphoblastic leukemia) | |||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
N-linked Glycosylation | |
Reference | PubMed |
"Mass-spectrometric identification and relative quantification of N-linked cell surface glycoproteins."; Wollscheid B., Bausch-Fluck D., Henderson C., O'Brien R., Bibel M.,Schiess R., Aebersold R., Watts J.D.; Nat. Biotechnol. 27:378-386(2009). Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-96, AND MASS SPECTROMETRY. | |
"Glycoproteomics analysis of human liver tissue by combination ofmultiple enzyme digestion and hydrazide chemistry."; Chen R., Jiang X., Sun D., Han G., Wang F., Ye M., Wang L., Zou H.; J. Proteome Res. 8:651-661(2009). Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-96, AND MASS SPECTROMETRY. |