CD003_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CD003_HUMAN
• UniProt AC: Q8WVX3
• Protein Name: Uncharacterized protein C4orf3
• Gene Name: C4orf3
• Organism: Homo sapiens (Human).
• Sequence Length: 66
• Subcellular Localization: Membrane ; Single-pass membrane protein .
• Protein Sequence: MEVDAPGVDGRDGLRERRGFSEGGRQNFDVRPQSGANGLPKHSYWLDLWLFILFDVVVFLFVYFLP

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
1	Acetylation	-------MEVDAPGV -------CCCCCCCC	11.62	22814378
2 (in isoform 2)	Phosphorylation	-	49.45	24043423
3 (in isoform 2)	Phosphorylation	-	8.00	24043423
7 (in isoform 2)	Phosphorylation	-	31.69	24043423
18	Methylation	RDGLRERRGFSEGGR CHHHHHCCCCCCCCC	45.84	115478323
21	Phosphorylation	LRERRGFSEGGRQNF HHHCCCCCCCCCCCC	37.85	25159151
34	Phosphorylation	NFDVRPQSGANGLPK CCCCCCCCCCCCCCC	42.42	25849741
65	Phosphorylation	VFLFVYFLP------ HHHHHHHCC------	2.42	24719451

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of CD003_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of CD003_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CD003_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
GCN1_HUMAN	GCN1L1	physical	26186194
PANX1_HUMAN	PANX1	physical	26186194
EDC4_HUMAN	EDC4	physical	26186194
DEGS1_HUMAN	DEGS1	physical	26186194
ERMP1_HUMAN	ERMP1	physical	26186194
PANX1_HUMAN	PANX1	physical	28514442
DEGS1_HUMAN	DEGS1	physical	28514442
EDC4_HUMAN	EDC4	physical	28514442
ERMP1_HUMAN	ERMP1	physical	28514442
GCN1_HUMAN	GCN1L1	physical	28514442

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.