| UniProt ID | CCL21_HUMAN | |
|---|---|---|
| UniProt AC | O00585 | |
| Protein Name | C-C motif chemokine 21 | |
| Gene Name | CCL21 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 134 | |
| Subcellular Localization | Secreted. | |
| Protein Description | Inhibits hemopoiesis and stimulates chemotaxis. Chemotactic in vitro for thymocytes and activated T-cells, but not for B-cells, macrophages, or neutrophils. Shows preferential activity towards naive T-cells. May play a role in mediating homing of lymphocytes to secondary lymphoid organs. Binds to atypical chemokine receptor ACKR4 and mediates the recruitment of beta-arrestin (ARRB1/2) to ACKR4.. | |
| Protein Sequence | MAQSLALSLLILVLAFGIPRTQGSDGGAQDCCLKYSQRKIPAKVVRSYRKQEPSLGCSIPAILFLPRKRSQAELCADPKELWVQQLMQHLDKTPSPQKPAQGCRKDRGASKTGKKGKGSKGCKRTERSQTPKGP | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 4 | Phosphorylation | ----MAQSLALSLLI ----CHHHHHHHHHH | 13.18 | 24043423 | |
| 8 | Phosphorylation | MAQSLALSLLILVLA CHHHHHHHHHHHHHH | 18.60 | 24043423 | |
| 114 | Acetylation | RGASKTGKKGKGSKG CCCCCCCCCCCCCCC | 64.68 | 88819 | |
| 115 | Methylation | GASKTGKKGKGSKGC CCCCCCCCCCCCCCC | 68.17 | - | |
| 115 | Acetylation | GASKTGKKGKGSKGC CCCCCCCCCCCCCCC | 68.17 | 88817 | |
| 117 | Methylation | SKTGKKGKGSKGCKR CCCCCCCCCCCCCCC | 69.74 | - | |
| 117 | Acetylation | SKTGKKGKGSKGCKR CCCCCCCCCCCCCCC | 69.74 | 88815 | |
| 120 | Methylation | GKKGKGSKGCKRTER CCCCCCCCCCCCCCC | 76.60 | - | |
| 120 | Acetylation | GKKGKGSKGCKRTER CCCCCCCCCCCCCCC | 76.60 | 88813 | |
| 123 | Methylation | GKGSKGCKRTERSQT CCCCCCCCCCCCCCC | 71.65 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CCL21_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CCL21_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CCL21_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| AATM_HUMAN | GOT2 | physical | 21900206 | |
| CLH2_HUMAN | CLTCL1 | physical | 28514442 | |
| TRIP6_HUMAN | TRIP6 | physical | 28514442 | |
| KLH26_HUMAN | KLHL26 | physical | 28514442 | |
| KLH22_HUMAN | KLHL22 | physical | 28514442 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
