UniProt ID | CAST2_HUMAN | |
---|---|---|
UniProt AC | A6NHX0 | |
Protein Name | Cytosolic arginine sensor for mTORC1 subunit 2 {ECO:0000312|HGNC:HGNC:37073} | |
Gene Name | CASTOR2 {ECO:0000303|PubMed:26972053, ECO:0000312|HGNC:HGNC:37073} | |
Organism | Homo sapiens (Human). | |
Sequence Length | 329 | |
Subcellular Localization | Cytoplasm, cytosol . | |
Protein Description | Functions as a negative regulator of the TORC1 signaling pathway through the GATOR complex. As part of homodimers or heterodimers with CASTOR1, directly binds and inhibits the GATOR subcomplex GATOR2 and thereby mTORC1. Does not directly bind arginine, but binding of arginine to CASTOR1 disrupts the interaction of CASTOR2-containing heterodimers with GATOR2 which can in turn activate mTORC1 and the TORC1 signaling pathway.. | |
Protein Sequence | MELHILEHRLQVASVAKESIPLFTYGLIKLAFLSSKTRCKFFSLTETPEDYTIIVDEEGFLELPSSEHLSVADATWLALNVVSGGGSFSSSQPIGVTKIAKSVIAPLADQNISVFMLSTYQTDFILVRERDLPFVTHTLSSEFTILRVVNGETVAAENLGITNGFVKPKLVQRPVIHPLSSPSNRFCVTSLDPDTLPAVATLLMDVMFYSNGVKDPMATGDDCGHIRFFSFSLIEGYISLVMDVQTQQRFPSNLLFTSASGELWKMVRIGGQPLGFDECGIVAQISEPLAAADIPAYYISTFKFDHALVPEENINGVISALKVSQAEKH | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
29 | Acetylation | LFTYGLIKLAFLSSK HHHHHHHHHHHHCCC | 11190477 | ||
36 | Acetylation | KLAFLSSKTRCKFFS HHHHHCCCCCEEEEE | 11190485 | ||
36 | Ubiquitination | KLAFLSSKTRCKFFS HHHHHCCCCCEEEEE | - | ||
167 | Ubiquitination | GITNGFVKPKLVQRP CCCCCCCCCCEECCC | 22817900 | ||
167 | Ubiquitination | GITNGFVKPKLVQRP CCCCCCCCCCEECCC | 21906983 | ||
169 | Ubiquitination | TNGFVKPKLVQRPVI CCCCCCCCEECCCEE | 22817900 | ||
322 | Ubiquitination | NGVISALKVSQAEKH CHHHHHHHHHHHCCC | 32015554 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CAST2_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CAST2_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CAST2_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
MIO_HUMAN | MIOS | physical | 26972053 | |
CAST2_HUMAN | GATSL2 | physical | 26972053 | |
CAST1_HUMAN | GATSL3 | physical | 26972053 | |
WDR24_HUMAN | WDR24 | physical | 26972053 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...