| UniProt ID | BORG1_HUMAN | |
|---|---|---|
| UniProt AC | O14613 | |
| Protein Name | Cdc42 effector protein 2 | |
| Gene Name | CDC42EP2 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 210 | |
| Subcellular Localization |
Endomembrane system Peripheral membrane protein . Cytoplasm, cytoskeleton . |
|
| Protein Description | Probably involved in the organization of the actin cytoskeleton. May act downstream of CDC42 to induce actin filament assembly leading to cell shape changes. Induces pseudopodia formation in fibroblasts in a CDC42-dependent manner.. | |
| Protein Sequence | MSTKVPIYLKRGSRKGKKEKLRDLLSSDMISPPLGDFRHTIHIGSGGGSDMFGDISFLQGKFHLLPGTMVEGPEEDGTFDLPFQFTRTATVCGRELPDGPSPLLKNAISLPVIGGPQALTLPTAQAPPKPPRLHLETPQPSPQEGGSVDIWRIPETGSPNSGLTPESGAEEPFLSNASSLLSLHVDLGPSILDDVLQIMDQDLDSMQIPT | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Phosphorylation | ------MSTKVPIYL ------CCCCCCEEE | 36.61 | 22167270 | |
| 2 | Acetylation | ------MSTKVPIYL ------CCCCCCEEE | 36.61 | 22814378 | |
| 3 | Phosphorylation | -----MSTKVPIYLK -----CCCCCCEEEC | 34.46 | 22167270 | |
| 8 | Phosphorylation | MSTKVPIYLKRGSRK CCCCCCEEECCCCCC | 10.49 | 29978859 | |
| 26 | Phosphorylation | EKLRDLLSSDMISPP HHHHHHHCCCCCCCC | 31.43 | 29396449 | |
| 27 | Phosphorylation | KLRDLLSSDMISPPL HHHHHHCCCCCCCCC | 31.03 | 29396449 | |
| 31 | Phosphorylation | LLSSDMISPPLGDFR HHCCCCCCCCCCCCC | 17.52 | 25159151 | |
| 45 | Phosphorylation | RHTIHIGSGGGSDMF CEEEEECCCCCCCCC | 33.39 | 28555341 | |
| 49 | Phosphorylation | HIGSGGGSDMFGDIS EECCCCCCCCCCCHH | 29.22 | 29214152 | |
| 56 | Phosphorylation | SDMFGDISFLQGKFH CCCCCCHHHHCCCEE | 25.33 | 28555341 | |
| 88 | Phosphorylation | LPFQFTRTATVCGRE CCEEEEEEEEECCCC | 24.50 | 22817900 | |
| 90 | Phosphorylation | FQFTRTATVCGRELP EEEEEEEEECCCCCC | 18.73 | 22817900 | |
| 101 | Phosphorylation | RELPDGPSPLLKNAI CCCCCCCCHHHHCCC | 33.44 | 29255136 | |
| 109 | Phosphorylation | PLLKNAISLPVIGGP HHHHCCCCCCCCCCC | 24.98 | 29255136 | |
| 120 | Phosphorylation | IGGPQALTLPTAQAP CCCCCCEECCCCCCC | 33.44 | 23312004 | |
| 123 | Phosphorylation | PQALTLPTAQAPPKP CCCEECCCCCCCCCC | 34.22 | 23312004 | |
| 137 | Phosphorylation | PPRLHLETPQPSPQE CCCEEEECCCCCCCC | 33.32 | 30266825 | |
| 141 | Phosphorylation | HLETPQPSPQEGGSV EEECCCCCCCCCCCE | 33.69 | 30266825 | |
| 147 | Phosphorylation | PSPQEGGSVDIWRIP CCCCCCCCEEEEECC | 27.72 | 23927012 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of BORG1_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of BORG1_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of BORG1_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| SEPT7_HUMAN | SEPT7 | physical | 11584266 | |
| SEPT6_HUMAN | SEPT6 | physical | 11584266 | |
| RHOQ_HUMAN | RHOQ | physical | 10490598 | |
| CDC42_HUMAN | CDC42 | physical | 10490598 | |
| RHG26_HUMAN | ARHGAP26 | physical | 25416956 | |
| NDK7_HUMAN | NME7 | physical | 25416956 | |
| RHG26_HUMAN | ARHGAP26 | physical | 21516116 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Phosphorylation | |
| Reference | PubMed |
| "Kinase-selective enrichment enables quantitative phosphoproteomics ofthe kinome across the cell cycle."; Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R.,Greff Z., Keri G., Stemmann O., Mann M.; Mol. Cell 31:438-448(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-31; SER-101 AND SER-141,AND MASS SPECTROMETRY. | |