UniProt ID | BMP4_HUMAN | |
---|---|---|
UniProt AC | P12644 | |
Protein Name | Bone morphogenetic protein 4 | |
Gene Name | BMP4 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 408 | |
Subcellular Localization | Secreted, extracellular space, extracellular matrix. | |
Protein Description | Induces cartilage and bone formation. Also act in mesoderm induction, tooth development, limb formation and fracture repair. Acts in concert with PTHLH/PTHRP to stimulate ductal outgrowth during embryonic mammary development and to inhibit hair follicle induction (By similarity).. | |
Protein Sequence | MIPGNRMLMVVLLCQVLLGGASHASLIPETGKKKVAEIQGHAGGRRSGQSHELLRDFEATLLQMFGLRRRPQPSKSAVIPDYMRDLYRLQSGEEEEEQIHSTGLEYPERPASRANTVRSFHHEEHLENIPGTSENSAFRFLFNLSSIPENEVISSAELRLFREQVDQGPDWERGFHRINIYEVMKPPAEVVPGHLITRLLDTRLVHHNVTRWETFDVSPAVLRWTREKQPNYGLAIEVTHLHQTRTHQGQHVRISRSLPQGSGNWAQLRPLLVTFGHDGRGHALTRRRRAKRSPKHHSQRARKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
50 | Phosphorylation | GGRRSGQSHELLRDF CCCCCCCCHHHHHHH | 23.58 | 26091039 | |
76 | Phosphorylation | RRPQPSKSAVIPDYM CCCCCCCCCCCCHHH | 31.91 | 26074081 | |
82 | Phosphorylation | KSAVIPDYMRDLYRL CCCCCCHHHHHHHHC | 6.68 | 26074081 | |
87 | Phosphorylation | PDYMRDLYRLQSGEE CHHHHHHHHCCCCCC | 17.36 | 26074081 | |
91 | Phosphorylation | RDLYRLQSGEEEEEQ HHHHHCCCCCCHHHH | 53.41 | 12404109 | |
106 | Phosphorylation | IHSTGLEYPERPASR HHHCCCCCCCCCCCC | 18.55 | 26091039 | |
116 | Phosphorylation | RPASRANTVRSFHHE CCCCCCCCHHHHCCH | 19.13 | - | |
119 | Phosphorylation | SRANTVRSFHHEEHL CCCCCHHHHCCHHHH | 25.29 | - | |
143 | N-linked_Glycosylation | SAFRFLFNLSSIPEN HHHHHHHCCCCCCCC | 40.95 | UniProtKB CARBOHYD | |
185 | Ubiquitination | INIYEVMKPPAEVVP EEEEEECCCCHHHCC | 53.69 | 2190698 | |
202 | Phosphorylation | LITRLLDTRLVHHNV HHHHHHHHCHHCCCC | 26.35 | 22210691 | |
208 | N-linked_Glycosylation | DTRLVHHNVTRWETF HHCHHCCCCCCEEEC | 23.21 | UniProtKB CARBOHYD | |
228 | Ubiquitination | VLRWTREKQPNYGLA HHHHHHCCCCCCEEE | 68.70 | - | |
350 | N-linked_Glycosylation | FPLADHLNSTNHAIV CCCHHHHCCCCHHHH | 43.28 | UniProtKB CARBOHYD | |
365 | N-linked_Glycosylation | QTLVNSVNSSIPKAC HHHHHHHCCCCCCHH | 29.84 | UniProtKB CARBOHYD |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
91 | S | Phosphorylation | Kinase | FAM20C | Q8IXL6 | Uniprot |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of BMP4_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of BMP4_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
BMR1A_HUMAN | BMPR1A | physical | 8006002 | |
BMR1B_HUMAN | BMPR1B | physical | 8006002 | |
DCA16_HUMAN | DCAF16 | physical | 28514442 | |
TWSG1_HUMAN | TWSG1 | physical | 28514442 | |
UBE2O_HUMAN | UBE2O | physical | 28514442 | |
PDP1_HUMAN | PDP1 | physical | 28514442 | |
SUFU_HUMAN | SUFU | physical | 28514442 | |
PROS_HUMAN | PROS1 | physical | 28514442 | |
CALR_HUMAN | CALR | physical | 28514442 |
loading...