| UniProt ID | BDNF_HUMAN | |
|---|---|---|
| UniProt AC | P23560 | |
| Protein Name | Brain-derived neurotrophic factor | |
| Gene Name | BDNF | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 247 | |
| Subcellular Localization | Secreted. | |
| Protein Description | During development, promotes the survival and differentiation of selected neuronal populations of the peripheral and central nervous systems. Participates in axonal growth, pathfinding and in the modulation of dendritic growth and morphology. Major regulator of synaptic transmission and plasticity at adult synapses in many regions of the CNS. The versatility of BDNF is emphasized by its contribution to a range of adaptive neuronal responses including long-term potentiation (LTP), long-term depression (LTD), certain forms of short-term synaptic plasticity, as well as homeostatic regulation of intrinsic neuronal excitability.. | |
| Protein Sequence | MTILFLTMVISYFGCMKAAPMKEANIRGQGGLAYPGVRTHGTLESVNGPKAGSRGLTSLADTFEHVIEELLDEDQKVRPNEENNKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAANMSMRVRRHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Phosphorylation | ------MTILFLTMV ------CCHHHHHHH | 26.79 | 29759185 | |
| 7 | Phosphorylation | -MTILFLTMVISYFG -CCHHHHHHHHHHHC | 11.32 | 24043423 | |
| 10 (in isoform 2) | Phosphorylation | - | 1.60 | 29523821 | |
| 11 | Phosphorylation | LFLTMVISYFGCMKA HHHHHHHHHHCHHHH | 11.73 | 26552605 | |
| 12 | Phosphorylation | FLTMVISYFGCMKAA HHHHHHHHHCHHHHC | 7.89 | 26552605 | |
| 15 (in isoform 2) | Phosphorylation | - | 1.49 | 29523821 | |
| 17 (in isoform 3) | Phosphorylation | - | 45.53 | 29523821 | |
| 19 (in isoform 2) | Phosphorylation | - | 10.13 | 29523821 | |
| 20 (in isoform 2) | Phosphorylation | - | 38.96 | 29523821 | |
| 22 (in isoform 3) | Phosphorylation | - | 53.25 | 29523821 | |
| 26 (in isoform 3) | Phosphorylation | - | 7.25 | 29523821 | |
| 27 (in isoform 3) | Phosphorylation | - | 31.05 | 29523821 | |
| 31 (in isoform 5) | Phosphorylation | - | 10.15 | 29523821 | |
| 36 (in isoform 5) | Phosphorylation | - | 14.63 | 29523821 | |
| 40 (in isoform 5) | Phosphorylation | - | 19.37 | 29523821 | |
| 41 (in isoform 5) | Phosphorylation | - | 31.23 | 29523821 | |
| 50 | Ubiquitination | LESVNGPKAGSRGLT EHHCCCCCCCCCCHH | 67.77 | - | |
| 62 | Phosphorylation | GLTSLADTFEHVIEE CHHHHHHHHHHHHHH | 25.89 | - | |
| 84 (in isoform 4) | Phosphorylation | - | 47.03 | 29523821 | |
| 85 | Ubiquitination | RPNEENNKDADLYTS CCCCCCCCCCCHHHH | 66.91 | - | |
| 85 | Acetylation | RPNEENNKDADLYTS CCCCCCCCCCCHHHH | 66.91 | 7678523 | |
| 89 (in isoform 4) | Phosphorylation | - | 5.57 | 29523821 | |
| 93 (in isoform 4) | Phosphorylation | - | 15.29 | 29523821 | |
| 94 (in isoform 4) | Phosphorylation | - | 4.54 | 29523821 | |
| 121 | N-linked_Glycosylation | KNYLDAANMSMRVRR HHHHHHHHHHHHHHH | 25.45 | 19467646 | |
| 155 | Phosphorylation | VTAADKKTAVDMSGG CHHCCCCEEEECCCC | 37.34 | - | |
| 174 | Ubiquitination | LEKVPVSKGQLKQYF EEEECCCCHHHHHEE | 51.41 | - | |
| 191 | Phosphorylation | TKCNPMGYTKEGCRG ECCCCCCCCCCCCCC | 14.37 | 18083107 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
| 62 | T | Phosphorylation | Kinase | CHEK2 | O96017 | GPS |
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of BDNF_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of BDNF_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| NTRK2_HUMAN | NTRK2 | physical | 9312147 | |
| NTRK2_HUMAN | NTRK2 | physical | 11855816 | |
| A4_HUMAN | APP | physical | 21832049 | |
| AGO3_HUMAN | AGO3 | physical | 21988832 | |
| JAM1_HUMAN | F11R | physical | 21988832 | |
| JUNB_HUMAN | JUNB | physical | 21988832 | |
| INP5K_HUMAN | INPP5K | physical | 21988832 | |
| NTF4_HUMAN | NTF4 | physical | 25241761 | |
| NTRK2_HUMAN | NTRK2 | physical | 21651720 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| 209880 | Congenital central hypoventilation syndrome (CCHS) | |||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
