UniProt ID | B4GT1_HUMAN | |
---|---|---|
UniProt AC | P15291 | |
Protein Name | Beta-1,4-galactosyltransferase 1 | |
Gene Name | B4GALT1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 398 | |
Subcellular Localization |
Isoform Long: Golgi apparatus, Golgi stack membrane Single-pass type II membrane protein. Cell membrane Single-pass type II membrane protein. Cell surface . Cell projection, filopodium . Found in trans cisternae of Golgi but is mainly localized a |
|
Protein Description | The Golgi complex form catalyzes the production of lactose in the lactating mammary gland and could also be responsible for the synthesis of complex-type N-linked oligosaccharides in many glycoproteins as well as the carbohydrate moieties of glycolipids.; The cell surface form functions as a recognition molecule during a variety of cell to cell and cell to matrix interactions, as those occurring during development and egg fertilization, by binding to specific oligosaccharide ligands on opposing cells or in the extracellular matrix.. | |
Protein Sequence | MRLREPLLSGSAAMPGASLQRACRLLVAVCALHLGVTLVYYLAGRDLSRLPQLVGVSTPLQGGSNSAAAIGQSSGELRTGGARPPPPLGASSQPRPGGDSSPVVDSGPGPASNLTSVPVPHTTALSLPACPEESPLLVGPMLIEFNMPVDLELVAKQNPNVKMGGRYAPRDCVSPHKVAIIIPFRNRQEHLKYWLYYLHPVLQRQQLDYGIYVINQAGDTIFNRAKLLNVGFQEALKDYDYTCFVFSDVDLIPMNDHNAYRCFSQPRHISVAMDKFGFSLPYVQYFGGVSALSKQQFLTINGFPNNYWGWGGEDDDIFNRLVFRGMSISRPNAVVGRCRMIRHSRDKKNEPNPQRFDRIAHTKETMLSDGLNSLTYQVLDVQRYPLYTQITVDIGTPS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
9 | Phosphorylation | RLREPLLSGSAAMPG CCCCCCCCCCCCCCC | 38.08 | 28555341 | |
23 | S-palmitoylation | GASLQRACRLLVAVC CHHHHHHHHHHHHHH | 3.25 | 29575903 | |
57 | Phosphorylation | LPQLVGVSTPLQGGS CCCCCCCCCCCCCCC | 20.55 | 23403867 | |
57 | O-linked_Glycosylation | LPQLVGVSTPLQGGS CCCCCCCCCCCCCCC | 20.55 | OGP | |
58 | O-linked_Glycosylation | PQLVGVSTPLQGGSN CCCCCCCCCCCCCCC | 26.13 | OGP | |
58 | Phosphorylation | PQLVGVSTPLQGGSN CCCCCCCCCCCCCCC | 26.13 | 23403867 | |
64 | O-linked_Glycosylation | STPLQGGSNSAAAIG CCCCCCCCCCCHHHC | 34.14 | OGP | |
64 | Phosphorylation | STPLQGGSNSAAAIG CCCCCCCCCCCHHHC | 34.14 | 23403867 | |
66 | Phosphorylation | PLQGGSNSAAAIGQS CCCCCCCCCHHHCCC | 22.45 | 23403867 | |
66 | O-linked_Glycosylation | PLQGGSNSAAAIGQS CCCCCCCCCHHHCCC | 22.45 | OGP | |
73 | Phosphorylation | SAAAIGQSSGELRTG CCHHHCCCCCCCCCC | 34.79 | 30278072 | |
74 | Phosphorylation | AAAIGQSSGELRTGG CHHHCCCCCCCCCCC | 28.53 | 28355574 | |
79 | O-linked_Glycosylation | QSSGELRTGGARPPP CCCCCCCCCCCCCCC | 53.22 | OGP | |
113 | N-linked_Glycosylation | SGPGPASNLTSVPVP CCCCCCCCCCCCCCC | 49.82 | UniProtKB CARBOHYD | |
115 | O-linked_Glycosylation | PGPASNLTSVPVPHT CCCCCCCCCCCCCCC | 31.74 | OGP | |
204 | Methylation | YLHPVLQRQQLDYGI HHHHHHHHHCCCCCE | 23.27 | - | |
270 | Phosphorylation | FSQPRHISVAMDKFG HCCCCEEEEEHHHHC | 9.56 | - | |
279 | O-linked_Glycosylation | AMDKFGFSLPYVQYF EHHHHCCCCCCHHHC | 28.90 | OGP | |
322 | Ubiquitination | DDIFNRLVFRGMSIS CHHHHHHHHCCCCCC | 2.51 | 21963094 | |
344 | Phosphorylation | RCRMIRHSRDKKNEP HHHHHCCCCCCCCCC | 32.12 | 24719451 | |
362 | O-linked_Glycosylation | RFDRIAHTKETMLSD HHHHHHHHHHHHHHC | 22.89 | OGP | |
363 | Ubiquitination | FDRIAHTKETMLSDG HHHHHHHHHHHHHCC | 41.12 | 21963094 | |
373 | Phosphorylation | MLSDGLNSLTYQVLD HHHCCHHHCEEEEEC | 27.42 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of B4GT1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of B4GT1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of B4GT1_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
LALBA_HUMAN | LALBA | physical | 11947697 | |
PLAK_HUMAN | JUP | physical | 22939629 | |
B4GT1_HUMAN | B4GALT1 | physical | 7744867 | |
TBA1A_HUMAN | TUBA1A | physical | 7744867 | |
TBB5_HUMAN | TUBB | physical | 7744867 |
loading...