| UniProt ID | B2L10_HUMAN | |
|---|---|---|
| UniProt AC | Q9HD36 | |
| Protein Name | Bcl-2-like protein 10 | |
| Gene Name | BCL2L10 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 194 | |
| Subcellular Localization | Mitochondrion . Nucleus membrane . | |
| Protein Description | Promotes cell survival. Suppresses apoptosis induced by BAX but not BAK.. | |
| Protein Sequence | MADPLRERTELLLADYLGYCAREPGTPEPAPSTPEAAVLRSAAARLRQIHRSFFSAYLGYPGNRFELVALMADSVLSDSPGPTWGRVVTLVTFAGTLLERGPLVTARWKKWGFQPRLKEQEGDVARDCQRLVALLSSRLMGQHRAWLQAQGGWDGFCHFFRTPFPLAFWRKQLVQAFLSCLLTTAFIYLWTRLL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 92 | Phosphorylation | GRVVTLVTFAGTLLE HHHHHHHHHHHHHHH | 15.75 | - | |
| 96 | Phosphorylation | TLVTFAGTLLERGPL HHHHHHHHHHHHCCC | 25.41 | - | |
| 109 | Ubiquitination | PLVTARWKKWGFQPR CCEEHHHHHCCCCCC | 32.85 | 21890473 | |
| 110 | Ubiquitination | LVTARWKKWGFQPRL CEEHHHHHCCCCCCH | 45.66 | 21890473 | |
| 119 | Ubiquitination | GFQPRLKEQEGDVAR CCCCCHHCCCCCHHH | 59.46 | 21890473 | |
| 120 | Ubiquitination | FQPRLKEQEGDVARD CCCCHHCCCCCHHHH | 59.39 | 21890473 | |
| 136 | Phosphorylation | QRLVALLSSRLMGQH HHHHHHHHHHHHHHH | 17.79 | 24719451 | |
| 137 | Phosphorylation | RLVALLSSRLMGQHR HHHHHHHHHHHHHHH | 29.42 | 24719451 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of B2L10_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of B2L10_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of B2L10_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| B2L10_HUMAN | BCL2L10 | physical | 11278245 | |
| BCL2_HUMAN | BCL2 | physical | 11278245 | |
| BAX_HUMAN | BAX | physical | 11278245 | |
| NR4A1_HUMAN | NR4A1 | physical | 18835031 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
