| UniProt ID | ATP6_YEAST | |
|---|---|---|
| UniProt AC | P00854 | |
| Protein Name | ATP synthase subunit a | |
| Gene Name | ATP6 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 259 | |
| Subcellular Localization |
Mitochondrion inner membrane Multi-pass membrane protein. |
|
| Protein Description | Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Key component of the proton channel; it may play a direct role in the translocation of protons across the membrane.. | |
| Protein Sequence | MFNLLNTYITSPLDQFEIRTLFGLQSSFIDLSCLNLTTFSLYTIIVLLVITSLYTLTNNNNKIIGSRWLISQEAIYDTIMNMTKGQIGGKNWGLYFPMIFTLFMFIFIANLISMIPYSFALSAHLVFIISLSIVIWLGNTILGLYKHGWVFFSLFVPAGTPLPLVPLLVIIETLSYFARAISLGLRLGSNILAGHLLMVILAGLTFNFMLINLFTLVFGFVPLAMILAIMMLEFAIGIIQGYVWAILTASYLKDAVYLH | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
|---|---|---|---|---|---|---|
Oops, there are no PTM records of ATP6_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ATP6_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ATP6_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ATP6_YEAST !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| RDS1_YEAST | RDS1 | physical | 18719252 | |
| ATP22_YEAST | ATP22 | genetic | 19841266 | |
| ATPA_YEAST | ATP1 | physical | 21266956 | |
| ATPD_YEAST | ATP16 | physical | 21266956 | |
| ATPB_YEAST | ATP2 | physical | 21266956 | |
| ATPG_YEAST | ATP3 | physical | 21266956 | |
| ATP5E_YEAST | ATP15 | physical | 21266956 | |
| ATPF_YEAST | ATP4 | physical | 21266956 | |
| ATP7_YEAST | ATP7 | physical | 21266956 | |
| ATP14_YEAST | ATP14 | physical | 21266956 | |
| ATP8_YEAST | ATP8 | physical | 21266956 | |
| ATP18_YEAST | ATP18 | physical | 21266956 | |
| COX3_YEAST | COX3 | physical | 21266956 | |
| ATP9_YEAST | OLI1 | physical | 21266956 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
