ATB21_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: ATB21_ARATH
• UniProt AC: Q9ZU70
• Protein Name: Homeobox-leucine zipper protein ATHB-21
• Gene Name: ATHB-21
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 220
• Subcellular Localization: Nucleus .
• Protein Description: Probable transcription factor..
• Protein Sequence: MNNQNVDDHNLLLISQLYPNVYTPLVPQQGGEAKPTRRRKRKSKSVVVAEEGENEGNGWFRKRKLSDEQVRMLEISFEDDHKLESERKDRLASELGLDPRQVAVWFQNRRARWKNKRVEDEYTKLKNAYETTVVEKCRLDSEVIHLKEQLYEAEREIQRLAKRVEGTLSNSPISSSVTIEANHTTPFFGDYDIGFDGEADENLLYSPDYIDGLDWMSQFM

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
123	Phosphorylation	KRVEDEYTKLKNAYE HHHHHHHHHHHHHHH	28.05	24894044

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of ATB21_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of ATB21_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of ATB21_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
AI5L7_ARATH	ABF4	physical	22669746
ATB22_ARATH	HB22	physical	16428600
ZHD1_ARATH	HB25	physical	16428600
ZHD11_ARATH	ZFHD1	physical	16428600

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.