UniProt ID | ASPD_HUMAN | |
---|---|---|
UniProt AC | A6ND91 | |
Protein Name | Putative L-aspartate dehydrogenase | |
Gene Name | ASPDH | |
Organism | Homo sapiens (Human). | |
Sequence Length | 283 | |
Subcellular Localization | ||
Protein Description | Specifically catalyzes the NAD or NADP-dependent dehydrogenation of L-aspartate to iminoaspartate.. | |
Protein Sequence | MADRGPWRVGVVGYGRLGQSLVSRLLAQGPELGLELVFVWNRDPGRMAGSVPPSLQLQNLAALGERRPDLVVEVAHPKIIHESGAQILRHANLLVGSPSALSDQTTERQLLEASQHWDHAVFVARGALWGAEDIRRLDAAGGLRSLRVTMATHPDGFRLEGPLAAAHSPGPCTVLYEGPVRGLCPFAPRNSNTMAAAALAAPSLGFDGVIGVLVADTSLTDMHVVDVELSGPRGPTGRSFAVHTRRENPAEPGAVTGSATVTAFWQSLLACCQLPSRPGIHLC | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
20 | Phosphorylation | GYGRLGQSLVSRLLA CCCHHHHHHHHHHHH | 29.01 | 28857561 | |
23 | Phosphorylation | RLGQSLVSRLLAQGP HHHHHHHHHHHHHCC | 23.62 | 24275569 | |
50 | Phosphorylation | DPGRMAGSVPPSLQL CCCCCCCCCCCCHHH | 23.16 | 30266825 | |
54 | Phosphorylation | MAGSVPPSLQLQNLA CCCCCCCCHHHHHHH | 23.76 | 30266825 | |
83 | Phosphorylation | HPKIIHESGAQILRH CCCEECHHHHHHHHH | 25.85 | 30243723 | |
168 | Phosphorylation | GPLAAAHSPGPCTVL CCEEECCCCCCEEEE | 27.16 | 20166139 | |
173 | Phosphorylation | AHSPGPCTVLYEGPV CCCCCCEEEEEECCC | 19.38 | 24275569 | |
191 | Phosphorylation | CPFAPRNSNTMAAAA CCCCCCCCCHHHHHH | 34.65 | 22210691 | |
193 | Phosphorylation | FAPRNSNTMAAAALA CCCCCCCHHHHHHHH | 14.17 | 22210691 | |
203 | Phosphorylation | AAALAAPSLGFDGVI HHHHHCHHHCCCCEE | 36.08 | 22210691 | |
230 | Phosphorylation | HVVDVELSGPRGPTG EEEEEEECCCCCCCC | 32.99 | 22210691 | |
236 | Phosphorylation | LSGPRGPTGRSFAVH ECCCCCCCCCCEEEE | 48.31 | 22210691 | |
239 | Phosphorylation | PRGPTGRSFAVHTRR CCCCCCCCEEEEECC | 20.92 | 24275569 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ASPD_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ASPD_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ASPD_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
TPM2_HUMAN | TPM2 | physical | 26186194 | |
SPC1L_HUMAN | SPATC1L | physical | 26186194 | |
COR1A_HUMAN | CORO1A | physical | 26344197 | |
COR1B_HUMAN | CORO1B | physical | 26344197 | |
GALK2_HUMAN | GALK2 | physical | 26344197 | |
UBE2N_HUMAN | UBE2N | physical | 26344197 | |
TPM2_HUMAN | TPM2 | physical | 28514442 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...