| UniProt ID | ASPD_HUMAN | |
|---|---|---|
| UniProt AC | A6ND91 | |
| Protein Name | Putative L-aspartate dehydrogenase | |
| Gene Name | ASPDH | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 283 | |
| Subcellular Localization | ||
| Protein Description | Specifically catalyzes the NAD or NADP-dependent dehydrogenation of L-aspartate to iminoaspartate.. | |
| Protein Sequence | MADRGPWRVGVVGYGRLGQSLVSRLLAQGPELGLELVFVWNRDPGRMAGSVPPSLQLQNLAALGERRPDLVVEVAHPKIIHESGAQILRHANLLVGSPSALSDQTTERQLLEASQHWDHAVFVARGALWGAEDIRRLDAAGGLRSLRVTMATHPDGFRLEGPLAAAHSPGPCTVLYEGPVRGLCPFAPRNSNTMAAAALAAPSLGFDGVIGVLVADTSLTDMHVVDVELSGPRGPTGRSFAVHTRRENPAEPGAVTGSATVTAFWQSLLACCQLPSRPGIHLC | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 20 | Phosphorylation | GYGRLGQSLVSRLLA CCCHHHHHHHHHHHH | 29.01 | 28857561 | |
| 23 | Phosphorylation | RLGQSLVSRLLAQGP HHHHHHHHHHHHHCC | 23.62 | 24275569 | |
| 50 | Phosphorylation | DPGRMAGSVPPSLQL CCCCCCCCCCCCHHH | 23.16 | 30266825 | |
| 54 | Phosphorylation | MAGSVPPSLQLQNLA CCCCCCCCHHHHHHH | 23.76 | 30266825 | |
| 83 | Phosphorylation | HPKIIHESGAQILRH CCCEECHHHHHHHHH | 25.85 | 30243723 | |
| 168 | Phosphorylation | GPLAAAHSPGPCTVL CCEEECCCCCCEEEE | 27.16 | 20166139 | |
| 173 | Phosphorylation | AHSPGPCTVLYEGPV CCCCCCEEEEEECCC | 19.38 | 24275569 | |
| 191 | Phosphorylation | CPFAPRNSNTMAAAA CCCCCCCCCHHHHHH | 34.65 | 22210691 | |
| 193 | Phosphorylation | FAPRNSNTMAAAALA CCCCCCCHHHHHHHH | 14.17 | 22210691 | |
| 203 | Phosphorylation | AAALAAPSLGFDGVI HHHHHCHHHCCCCEE | 36.08 | 22210691 | |
| 230 | Phosphorylation | HVVDVELSGPRGPTG EEEEEEECCCCCCCC | 32.99 | 22210691 | |
| 236 | Phosphorylation | LSGPRGPTGRSFAVH ECCCCCCCCCCEEEE | 48.31 | 22210691 | |
| 239 | Phosphorylation | PRGPTGRSFAVHTRR CCCCCCCCEEEEECC | 20.92 | 24275569 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ASPD_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ASPD_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ASPD_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| TPM2_HUMAN | TPM2 | physical | 26186194 | |
| SPC1L_HUMAN | SPATC1L | physical | 26186194 | |
| COR1A_HUMAN | CORO1A | physical | 26344197 | |
| COR1B_HUMAN | CORO1B | physical | 26344197 | |
| GALK2_HUMAN | GALK2 | physical | 26344197 | |
| UBE2N_HUMAN | UBE2N | physical | 26344197 | |
| TPM2_HUMAN | TPM2 | physical | 28514442 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
