UniProt ID | ARL11_HUMAN | |
---|---|---|
UniProt AC | Q969Q4 | |
Protein Name | ADP-ribosylation factor-like protein 11 | |
Gene Name | ARL11 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 196 | |
Subcellular Localization | ||
Protein Description | May play a role in apoptosis. May act as a tumor suppressor.. | |
Protein Sequence | MGSVNSRGHKAEAQVVMMGLDSAGKTTLLYKLKGHQLVETLPTVGFNVEPLKAPGHVSLTLWDVGGQAPLRASWKDYLEGTDILVYVLDSTDEARLPESAAELTEVLNDPNMAGVPFLVLANKQEAPDALPLLKIRNRLSLERFQDHCWELRGCSALTGEGLPEALQSLWSLLKSRSCMCLQARAHGAERGDSKRS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Myristoylation | ------MGSVNSRGH ------CCCCCCCCC | 40.06 | - | |
6 | Phosphorylation | --MGSVNSRGHKAEA --CCCCCCCCCHHHE | 37.17 | 18187866 | |
22 | Phosphorylation | VVMMGLDSAGKTTLL EEEEECCCCCCEEEE | 43.92 | 26074081 | |
25 | Ubiquitination | MGLDSAGKTTLLYKL EECCCCCCEEEEEEE | 37.74 | 23000965 | |
26 | Phosphorylation | GLDSAGKTTLLYKLK ECCCCCCEEEEEEEC | 23.04 | 26074081 | |
27 | Phosphorylation | LDSAGKTTLLYKLKG CCCCCCEEEEEEECC | 20.46 | 26074081 | |
30 | Phosphorylation | AGKTTLLYKLKGHQL CCCEEEEEEECCCCC | 19.86 | 28152594 | |
31 | Ubiquitination | GKTTLLYKLKGHQLV CCEEEEEEECCCCCE | 43.63 | 23000965 | |
31 | Acetylation | GKTTLLYKLKGHQLV CCEEEEEEECCCCCE | 43.63 | 23236377 | |
31 | 2-Hydroxyisobutyrylation | GKTTLLYKLKGHQLV CCEEEEEEECCCCCE | 43.63 | - | |
31 | Malonylation | GKTTLLYKLKGHQLV CCEEEEEEECCCCCE | 43.63 | 26320211 | |
33 | Ubiquitination | TTLLYKLKGHQLVET EEEEEEECCCCCEEE | 50.63 | 23000965 | |
40 | Phosphorylation | KGHQLVETLPTVGFN CCCCCEEECCCCCEE | 30.47 | 26074081 | |
73 | Phosphorylation | GQAPLRASWKDYLEG CCCCCCCCHHHHHCC | 28.38 | 24719451 | |
134 | Ubiquitination | PDALPLLKIRNRLSL CCHHHHHHHHHCCCH | 47.50 | - | |
171 | Phosphorylation | EALQSLWSLLKSRSC HHHHHHHHHHHHCCC | 29.17 | 24719451 | |
175 | Phosphorylation | SLWSLLKSRSCMCLQ HHHHHHHHCCCHHHH | 29.42 | 24719451 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ARL11_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ARL11_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ARL11_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
PCH2_HUMAN | TRIP13 | physical | 19060904 | |
SESD1_HUMAN | SESTD1 | physical | 28514442 | |
MTMR8_HUMAN | MTMR8 | physical | 28514442 | |
SENP1_HUMAN | SENP1 | physical | 28514442 | |
SBP1_HUMAN | SELENBP1 | physical | 28514442 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
151400 | Leukemia, chronic lymphocytic (CLL) | |||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"Automated phosphoproteome analysis for cultured cancer cells by two-dimensional nanoLC-MS using a calcined titania/C18 biphasic column."; Imami K., Sugiyama N., Kyono Y., Tomita M., Ishihama Y.; Anal. Sci. 24:161-166(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-6, AND MASSSPECTROMETRY. |