ARA2_YEAST - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: ARA2_YEAST
• UniProt AC: Q04212
• Protein Name: D-arabinose 1-dehydrogenase
• Gene Name: ARA2
• Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
• Sequence Length: 335
• Protein Sequence: MVNEKVNPFDLASVSPLVLGGAILNQQYTDEPESIPLEDIIKYAFSHGINAIDTSPYYGPSEVLYGRALSNLRNEFPRDTYFICTKVGRIGAEEFNYSRDFVRFSVHRSCERLHTTYLDLVYLHDVEFVKFPDILEALKELRTLKNKGVIKNFGISGYPIDFITWLAEYCSTEESDIGSLDAVLSYCNLNLQNNKLLNFRERLLRNAKLKMVCNASILSMSLLRSQETRQFHPCSHELRECASQAAKYCQEQNVDLADLATRYAISEWVGKGPVVLGVSSMEELKLALDNYEIVKSNGNRLSSKDGQLVEYIQKNIFKEHFNEEWSSGIPHPEMI

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
263	Phosphorylation	LADLATRYAISEWVG HHHHHHHHHHHHHHC	12.16	28889911

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of ARA2_YEAST !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of ARA2_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of ARA2_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
PRP9_YEAST	PRP9	genetic	27708008
CDC1_YEAST	CDC1	genetic	27708008
GPI11_YEAST	GPI11	genetic	27708008
RPB7_YEAST	RPB7	genetic	27708008
MED14_YEAST	RGR1	genetic	27708008
RSC9_YEAST	RSC9	genetic	27708008

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.