APH1_DROME - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: APH1_DROME
• UniProt AC: Q9VQG2
• Protein Name: Gamma-secretase subunit Aph-1
• Gene Name: aph-1
• Organism: Drosophila melanogaster (Fruit fly).
• Sequence Length: 238
• Subcellular Localization: Membrane ; Multi-pass membrane protein .
• Protein Description: Essential subunit of the gamma-secretase complex, an endoprotease complex that catalyzes the intramembrane cleavage of integral membrane proteins such as Notch. It probably represents a stabilizing cofactor for the presenilin homodimer that promotes the formation of a stable complex..
• Protein Sequence: MTLPEFFGCTFIAFGPPFALFVFTIANDPVRIIILIAAAFFWLLSLLISSLWYALIPLKEFLAFGVVFSVCFQEAFRYIIYRILRSTEQGLHAVAEDTRVTDNKHILAYVSGLGFGIISGMFALVNVLADMSGPGTMGLKGGTELFFVTSAAQALSIILLHTFWSVIFFNAFDTNNYIHIGYVVFSHLFVSLITLLNANELYTTTLLINYLVTILTGVLAFRVAGGTSRSFRKFITCQ

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of APH1_DROME !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of APH1_DROME !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of APH1_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of APH1_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
NOTCH_DROME	N	genetic	12771124
CRB_DROME	crb	genetic	20110329
PEN2_DROME	pen-2	physical	20421416
PSN_DROME	Psn	physical	20421416
NICA_DROME	nct	physical	20421416

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.