| UniProt ID | APC13_SCHPO | |
|---|---|---|
| UniProt AC | O74358 | |
| Protein Name | Anaphase-promoting complex subunit 13 | |
| Gene Name | apc13 | |
| Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
| Sequence Length | 135 | |
| Subcellular Localization | ||
| Protein Description | Component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin-protein ligase complex that controls progression through mitosis and the G1 phase of the cell cycle. The APC/C is thought to confer substrate specificity and, in the presence of ubiquitin-conjugating E2 enzymes, it catalyzes the formation of protein-ubiquitin conjugates that are subsequently degraded by the 26S proteasome.. | |
| Protein Sequence | MDSNYNYVHMNKPGVVLFASDWLKDRLPVDDVEVRVEHLPPVTEDEMTIQHSSANLILMKNKQLRHEPAWKDLELEDLVNAFAFIQGSSNAEGKNTIEDNFETDPFKSVKEAPMAPFLEANRRHQGEHASMRYFR | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
|---|---|---|---|---|---|---|
Oops, there are no PTM records of APC13_SCHPO !! | ||||||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of APC13_SCHPO !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of APC13_SCHPO !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of APC13_SCHPO !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| APC4_SCHPO | cut20 | physical | 12477395 | |
| APC1_SCHPO | cut4 | physical | 12477395 | |
| APC2_SCHPO | apc2 | physical | 12477395 | |
| APC3_SCHPO | nuc2 | physical | 12477395 | |
| APC5_SCHPO | apc5 | physical | 12477395 | |
| CUT9_SCHPO | cut9 | physical | 12477395 | |
| APC8_SCHPO | cut23 | physical | 12477395 | |
| APC10_SCHPO | apc10 | physical | 12477395 | |
| APC11_SCHPO | apc11 | physical | 12477395 | |
| HCN1_SCHPO | hcn1 | physical | 12477395 | |
| APC14_SCHPO | apc14 | physical | 12477395 | |
| APC15_SCHPO | apc15 | physical | 12477395 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
