APC11_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: APC11_SCHPO
• UniProt AC: Q9UT86
• Protein Name: Anaphase-promoting complex subunit 11
• Gene Name: apc11
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 94
• Protein Description: Component of the anaphase-promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin-protein ligase complex that controls progression through mitosis and the G1 phase of the cell cycle. The APC/C is thought to confer substrate specificity and, in the presence of ubiquitin-conjugating E2 enzymes, it catalyzes the formation of protein-ubiquitin conjugates that are subsequently degraded by the 26S proteasome..
• Protein Sequence: MKVKILRYHAIANWTWDTPKDDVCGICRVPFDGCCPQCTSPGDNCPIVWGKCKHIFHAHCIQNWLATSGSQGQCPMDRQTFVVADSTNEKSETQ

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of APC11_SCHPO !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of APC11_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of APC11_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of APC11_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
APC11_SCHPO	apc11	physical	22809626
UBC1_SCHPO	ubc1	physical	21389117
UBC4_SCHPO	ubc4	physical	21389117
UBC11_SCHPO	ubc11	physical	21389117
APC2_SCHPO	apc2	physical	26771498

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.