UniProt ID | APC14_SCHPO | |
---|---|---|
UniProt AC | O42659 | |
Protein Name | Anaphase-promoting complex subunit 14 | |
Gene Name | apc14 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 107 | |
Subcellular Localization | Spore wall, perispore . Outer spore wall. | |
Protein Description | Component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin-protein ligase complex that controls progression through mitosis and the G1 phase of the cell cycle. The APC/C is thought to confer substrate specificity and, in the presence of ubiquitin-conjugating E2 enzymes, it catalyzes the formation of protein-ubiquitin conjugates that are subsequently degraded by the 26S proteasome. Appears to have some sort of role in spore wall formation.. | |
Protein Sequence | MDPFAGTGQSKSYRTFGNVFQRLSMSGNPKPLAKKPLLLPEASKAIEFWNYRDVIGGEEAEQERNERASRIAISRIASSRSSIPEYRQAIMQHLTKHVQQLDQLAEW | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of APC14_SCHPO !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of APC14_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of APC14_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of APC14_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
APC15_SCHPO | apc15 | genetic | 12477395 | |
CUT9_SCHPO | cut9 | physical | 12477395 | |
APC15_SCHPO | apc15 | physical | 12477395 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...