APC14_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: APC14_SCHPO
• UniProt AC: O42659
• Protein Name: Anaphase-promoting complex subunit 14
• Gene Name: apc14
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 107
• Subcellular Localization: Spore wall, perispore . Outer spore wall.
• Protein Description: Component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin-protein ligase complex that controls progression through mitosis and the G1 phase of the cell cycle. The APC/C is thought to confer substrate specificity and, in the presence of ubiquitin-conjugating E2 enzymes, it catalyzes the formation of protein-ubiquitin conjugates that are subsequently degraded by the 26S proteasome. Appears to have some sort of role in spore wall formation..
• Protein Sequence: MDPFAGTGQSKSYRTFGNVFQRLSMSGNPKPLAKKPLLLPEASKAIEFWNYRDVIGGEEAEQERNERASRIAISRIASSRSSIPEYRQAIMQHLTKHVQQLDQLAEW

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of APC14_SCHPO !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of APC14_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of APC14_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of APC14_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
APC15_SCHPO	apc15	genetic	12477395
CUT9_SCHPO	cut9	physical	12477395
APC15_SCHPO	apc15	physical	12477395

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.