HCN1_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: HCN1_SCHPO
• UniProt AC: O13916
• Protein Name: Anaphase-promoting complex subunit hcn1
• Gene Name: hcn1
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 80
• Protein Description: Component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin-protein ligase complex that controls progression through mitosis and the G1 phase of the cell cycle. The APC/C is thought to confer substrate specificity and, in the presence of ubiquitin-conjugating E2 enzymes, it catalyzes the formation of protein-ubiquitin conjugates that are subsequently degraded by the 26S proteasome. Has a role in assembling cut9 in the 20S APC/cyclosome..
• Protein Sequence: MLRRNPTAIQITAEDVLAYDEEKLRQTLDSESTTEEALQKNEESTRLSPEKKKIIRERRIGITQIFDSSMHPSQGGAAQS

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
1	Acetylation	-------MLRRNPTA -------CCCCCCCC	6.23	20924356
30	Phosphorylation	KLRQTLDSESTTEEA HHHHHHCCCCCHHHH	36.24	21712547
32	Phosphorylation	RQTLDSESTTEEALQ HHHHCCCCCHHHHHH	44.58	24763107
33	Phosphorylation	QTLDSESTTEEALQK HHHCCCCCHHHHHHH	33.89	21712547
44	Phosphorylation	ALQKNEESTRLSPEK HHHHCHHHHCCCHHH	16.79	21712547
45	Phosphorylation	LQKNEESTRLSPEKK HHHCHHHHCCCHHHH	38.62	24763107
48	Phosphorylation	NEESTRLSPEKKKII CHHHHCCCHHHHHHH	27.93	24763107
80	Phosphorylation	SQGGAAQS------- CCCCCCCC-------	37.15	25720772

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of HCN1_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of HCN1_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of HCN1_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
CUT9_SCHPO	cut9	physical	16950791
CUT9_SCHPO	cut9	physical	26771498

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.