| UniProt ID | AP3M_ARATH | |
|---|---|---|
| UniProt AC | F4I562 | |
| Protein Name | AP-3 complex subunit mu | |
| Gene Name | AP3M | |
| Organism | Arabidopsis thaliana (Mouse-ear cress). | |
| Sequence Length | 415 | |
| Subcellular Localization |
Cytoplasm. Golgi apparatus. Cytoplasmic vesicle membrane Peripheral membrane protein Cytoplasmic side. Component of the coat surrounding the cytoplasmic face of coated vesicles located at the Golgi complex.. |
|
| Protein Description | Part of the AP-3 complex, an adaptor-related complex which seems to be clathrin-associated. The complex is associated with the Golgi region as well as more peripheral structures. It facilitates the budding of vesicles from the Golgi membrane and may be directly involved in trafficking to the vacuole. It also functions in maintaining the identity of lytic vacuoles and in regulating the transition between storage and lytic vacuoles.. | |
| Protein Sequence | MLQCIFLISDSGEVMLEKQLTGHRVDRSICAWFWDQYISQGDSFKALPVIASPTHYLFQIVRDGITFLACSQVEMPPLMAIEFLCRVADVLSEYLGGLNEDLIKDNFIIVYELLDEMIDNGFPLTTEPSILKEMIAPPNLVSKMLSVVTGNASNVSDTLPSGAGSCVPWRPTDPKYSSNEVYVDLVEEMDAIVNRDGELVKCEIYGEVQMNSQLTGFPDLTLSFANPSILEDMRFHPCVRYRPWESHQVLSFVPPDGEFKLMSYRVKKLKNTPVYVKPQITSDSGTCRISVLVGIRSDPGKTIESITLSFQLPHCVSSADLSSNHGTVTILSNKTCTWTIGRIPKDKTPCLSGTLALEPGLERLHVFPTFKLGFKIMGIALSGLRIEKLDLQTIPPRLYKGFRAQTRAGEFDVRL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
|---|---|---|---|---|---|---|
Oops, there are no PTM records of AP3M_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of AP3M_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of AP3M_ARATH !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of AP3M_ARATH !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| DMS3_ARATH | DMS3 | physical | 21798944 | |
| CSN5B_ARATH | CSN5B | physical | 21798944 | |
| GBB_ARATH | AGB1 | physical | 24098050 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
