dbPTM

ALLC_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	ALLC_SCHPO
UniProt AC	Q09913
Protein Name	Probable allantoicase
Gene Name	SPAC1F7.09c
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	342
Subcellular Localization
Protein Description	Utilization of purines as secondary nitrogen sources, when primary sources are limiting..
Protein Sequence	MSVENVERLSPEQADAFFGQSSVDLISRALGGQVLGCSDDFFASCENLINPADPIRKAGVFVETGAWYDGWETRRHNTAPCDWVIVKLGPSSGRVTGCEIDTTFFNGNHAPEVSVEAAFLPEGNPDAKTNWTPILPKLPCGPTQRHIYRFKEIPQQNFTHVRLCMYPDGGIARFRLYGNVVPVFPADLDARLDLAHMYLGGLVVQCSDQHFGKKDNLLLPGRGVNMGDGWETARSREKGHVDWVIVKLGARGYIDDALIDTNHFKGNYPKEVILEAIDSPDHIPGPDAQWVTILPARKLGPHMEHVFTNLQNNSTPMTHVRMIIIPDGGVKRLRIYGRRAAN

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of ALLC_SCHPO !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of ALLC_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of ALLC_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of ALLC_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
ALLC_SCHPO	SPAC1F7.09c	physical	26771498
YF75_SCHPO	spa2	physical	26771498
MOC3_SCHPO	moc3	physical	26771498
CWF17_SCHPO	spf38	physical	26771498
IMA2_SCHPO	imp1	physical	26771498

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of ALLC_SCHPO

Related Literatures of Post-Translational Modification