AGP16_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: AGP16_ARATH
• UniProt AC: O82337
• Protein Name: Arabinogalactan protein 16 {ECO:0000303|PubMed:11006345}
• Gene Name: AGP16 {ECO:0000303|PubMed:11006345}
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 73
• Subcellular Localization: Cell membrane ; Lipid-anchor, GPI-anchor .
• Protein Description: Proteoglycan that seems to be implicated in diverse developmental roles such as differentiation, cell-cell recognition, embryogenesis and programmed cell death..
• Protein Sequence: MASRNSVTGFALFSFVFAVILSLAGAQSLAPAPAPTSDGTSIDQGIAYLLMVVALVLTYLIHPLDASSSYSFF

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
27	Pyrrolidone_carboxylic_acid	ILSLAGAQSLAPAPA HHHHHCHHHHCCCCC	37.75	-
27	Pyrrolidone_carboxylic_acid	ILSLAGAQSLAPAPA HHHHHCHHHHCCCCC	37.75	15322080
27	Pyrrolidone_carboxylic_acid	ILSLAGAQSLAPAPA HHHHHCHHHHCCCCC	37.75	11006345
31	Hydroxylation	AGAQSLAPAPAPTSD HCHHHHCCCCCCCCC	44.03	15322080
31	O-linked_Glycosylation	AGAQSLAPAPAPTSD HCHHHHCCCCCCCCC	44.03	15322080
33	Hydroxylation	AQSLAPAPAPTSDGT HHHHCCCCCCCCCCC	37.40	15322080
33	O-linked_Glycosylation	AQSLAPAPAPTSDGT HHHHCCCCCCCCCCC	37.40	15322080
35	Hydroxylation	SLAPAPAPTSDGTSI HHCCCCCCCCCCCCH	31.23	15322080
35	O-linked_Glycosylation	SLAPAPAPTSDGTSI HHCCCCCCCCCCCCH	31.23	15322080
37	GPI-anchor	APAPAPTSDGTSIDQ CCCCCCCCCCCCHHH	32.74	15322080

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of AGP16_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
31	P	Hydroxylation	Contains 4-hydroxyproline; hydroxylated on Pro-31, Pro-33 and Pro-35.	11006345
33	P	Hydroxylation	Contains 4-hydroxyproline; hydroxylated on Pro-31, Pro-33 and Pro-35.	11006345
35	P	Hydroxylation	Contains 4-hydroxyproline; hydroxylated on Pro-31, Pro-33 and Pro-35.	11006345

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of AGP16_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
UTR2_ARATH	UTR2	physical	24833385
PIP13_ARATH	PIP1C	physical	24833385
UTR3_ARATH	UTR3	physical	24833385
AB12I_ARATH	AT3G21580	physical	24833385
CNIH1_ARATH	AT3G12180	physical	24833385
CP21D_ARATH	AT3G66654	physical	24833385
BETL2_ARATH	AT1G29060	physical	24833385

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.