UniProt ID | AGP16_ARATH | |
---|---|---|
UniProt AC | O82337 | |
Protein Name | Arabinogalactan protein 16 {ECO:0000303|PubMed:11006345} | |
Gene Name | AGP16 {ECO:0000303|PubMed:11006345} | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 73 | |
Subcellular Localization |
Cell membrane Lipid-anchor, GPI-anchor . |
|
Protein Description | Proteoglycan that seems to be implicated in diverse developmental roles such as differentiation, cell-cell recognition, embryogenesis and programmed cell death.. | |
Protein Sequence | MASRNSVTGFALFSFVFAVILSLAGAQSLAPAPAPTSDGTSIDQGIAYLLMVVALVLTYLIHPLDASSSYSFF | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
27 | Pyrrolidone_carboxylic_acid | ILSLAGAQSLAPAPA HHHHHCHHHHCCCCC | 37.75 | - | |
27 | Pyrrolidone_carboxylic_acid | ILSLAGAQSLAPAPA HHHHHCHHHHCCCCC | 37.75 | 15322080 | |
27 | Pyrrolidone_carboxylic_acid | ILSLAGAQSLAPAPA HHHHHCHHHHCCCCC | 37.75 | 11006345 | |
31 | Hydroxylation | AGAQSLAPAPAPTSD HCHHHHCCCCCCCCC | 44.03 | 15322080 | |
31 | O-linked_Glycosylation | AGAQSLAPAPAPTSD HCHHHHCCCCCCCCC | 44.03 | 15322080 | |
33 | Hydroxylation | AQSLAPAPAPTSDGT HHHHCCCCCCCCCCC | 37.40 | 15322080 | |
33 | O-linked_Glycosylation | AQSLAPAPAPTSDGT HHHHCCCCCCCCCCC | 37.40 | 15322080 | |
35 | Hydroxylation | SLAPAPAPTSDGTSI HHCCCCCCCCCCCCH | 31.23 | 15322080 | |
35 | O-linked_Glycosylation | SLAPAPAPTSDGTSI HHCCCCCCCCCCCCH | 31.23 | 15322080 | |
37 | GPI-anchor | APAPAPTSDGTSIDQ CCCCCCCCCCCCHHH | 32.74 | 15322080 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of AGP16_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of AGP16_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
UTR2_ARATH | UTR2 | physical | 24833385 | |
PIP13_ARATH | PIP1C | physical | 24833385 | |
UTR3_ARATH | UTR3 | physical | 24833385 | |
AB12I_ARATH | AT3G21580 | physical | 24833385 | |
CNIH1_ARATH | AT3G12180 | physical | 24833385 | |
CP21D_ARATH | AT3G66654 | physical | 24833385 | |
BETL2_ARATH | AT1G29060 | physical | 24833385 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...