| UniProt ID | ADIPO_HUMAN | |
|---|---|---|
| UniProt AC | Q15848 | |
| Protein Name | Adiponectin | |
| Gene Name | ADIPOQ | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 244 | |
| Subcellular Localization | Secreted. | |
| Protein Description | Important adipokine involved in the control of fat metabolism and insulin sensitivity, with direct anti-diabetic, anti-atherogenic and anti-inflammatory activities. Stimulates AMPK phosphorylation and activation in the liver and the skeletal muscle, enhancing glucose utilization and fatty-acid combustion. Antagonizes TNF-alpha by negatively regulating its expression in various tissues such as liver and macrophages, and also by counteracting its effects. Inhibits endothelial NF-kappa-B signaling through a cAMP-dependent pathway. May play a role in cell growth, angiogenesis and tissue remodeling by binding and sequestering various growth factors with distinct binding affinities, depending on the type of complex, LMW, MMW or HMW.. | |
| Protein Sequence | MLLLGAVLLLLALPGHDQETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDGTPGEKGEKGDPGLIGPKGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTN | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 21 | O-linked_Glycosylation | PGHDQETTTQGPGVL CCCCCCCCCCCCCEE | 19.17 | 19855092 | |
| 22 | O-linked_Glycosylation | GHDQETTTQGPGVLL CCCCCCCCCCCCEEE | 38.66 | 19855092 | |
| 33 | Hydroxylation | GVLLPLPKGACTGWM CEEEECCCCCCCCHH | 67.81 | - | |
| 36 | Succinylation | LPLPKGACTGWMAGI EECCCCCCCCHHCCC | 5.01 | - | |
| 44 | Hydroxylation | TGWMAGIPGHPGHNG CCHHCCCCCCCCCCC | 33.84 | 16497731 | |
| 47 | Hydroxylation | MAGIPGHPGHNGAPG HCCCCCCCCCCCCCC | 52.21 | 16497731 | |
| 53 | Hydroxylation | HPGHNGAPGRDGRDG CCCCCCCCCCCCCCC | 39.49 | 16497731 | |
| 65 | O-linked_Glycosylation | RDGTPGEKGEKGDPG CCCCCCCCCCCCCCC | 77.58 | 11912203 | |
| 65 | Hydroxylation | RDGTPGEKGEKGDPG CCCCCCCCCCCCCCC | 77.58 | 16497731 | |
| 68 | Hydroxylation | TPGEKGEKGDPGLIG CCCCCCCCCCCCCCC | 76.82 | 16497731 | |
| 68 | O-linked_Glycosylation | TPGEKGEKGDPGLIG CCCCCCCCCCCCCCC | 76.82 | 11912203 | |
| 71 | Hydroxylation | EKGEKGDPGLIGPKG CCCCCCCCCCCCCCC | 48.43 | 16497731 | |
| 76 | Hydroxylation | GDPGLIGPKGDIGET CCCCCCCCCCCCCCC | 30.38 | 16497731 | |
| 77 | Hydroxylation | DPGLIGPKGDIGETG CCCCCCCCCCCCCCC | 65.09 | 16497731 | |
| 77 | O-linked_Glycosylation | DPGLIGPKGDIGETG CCCCCCCCCCCCCCC | 65.09 | 11912203 | |
| 83 | Phosphorylation | PKGDIGETGVPGAEG CCCCCCCCCCCCCCC | 37.96 | 22985185 | |
| 91 | Hydroxylation | GVPGAEGPRGFPGIQ CCCCCCCCCCCCCCC | 25.40 | 16497731 | |
| 95 | Hydroxylation | AEGPRGFPGIQGRKG CCCCCCCCCCCCCCC | 41.63 | 16497731 | |
| 101 | Hydroxylation | FPGIQGRKGEPGEGA CCCCCCCCCCCCCCC | 74.56 | 16497731 | |
| 101 | O-linked_Glycosylation | FPGIQGRKGEPGEGA CCCCCCCCCCCCCCC | 74.56 | 11912203 | |
| 116 | Phosphorylation | YVYRSAFSVGLETYV EEEEEEEEEECEEEE | 18.26 | 22210691 | |
| 122 | Phosphorylation | FSVGLETYVTIPNMP EEEECEEEEECCCCC | 6.04 | 22210691 | |
| 174 | Phosphorylation | YMKDVKVSLFKKDKA EECCEEEEEEECCEE | 23.52 | 24719451 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ADIPO_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ADIPO_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ADIPO_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| PDGFB_HUMAN | PDGFB | physical | 12070119 | |
| ADIPO_HUMAN | ADIPOQ | physical | 12021245 | |
| ADIPO_HUMAN | ADIPOQ | physical | 19855092 | |
| KASH5_HUMAN | CCDC155 | physical | 25416956 | |
| SYNE4_HUMAN | SYNE4 | physical | 25416956 |
loading...
| Hydroxylation | |
| Reference | PubMed |
| "Adiponectin multimerization is dependent on conserved lysines in thecollagenous domain: evidence for regulation of multimerization byalterations in posttranslational modifications."; Richards A.A., Stephens T., Charlton H.K., Jones A., Macdonald G.A.,Prins J.B., Whitehead J.P.; Mol. Endocrinol. 20:1673-1687(2006). Cited for: SUBUNIT, HYDROXYLATION AT PRO-44; PRO-47; PRO-53; LYS-65; LYS-68;PRO-71; PRO-76; LYS-77; PRO-91; PRO-95 AND LYS-101, GLYCOSYLATION ATLYS-65; LYS-68; LYS-77 AND LYS-101, DISULFIDE BOND, LACK OFHYDROXYLATION AT PRO-62; PRO-86 AND PRO-104, LACK OF GLYCOSYLATION ATASN-230, MUTAGENESIS OF LYS-33; CYS-36; LYS-65; LYS-68; LYS-77 ANDLYS-101, AND MASS SPECTROMETRY. | |
| O-linked Glycosylation | |
| Reference | PubMed |
| "Adiponectin multimerization is dependent on conserved lysines in thecollagenous domain: evidence for regulation of multimerization byalterations in posttranslational modifications."; Richards A.A., Stephens T., Charlton H.K., Jones A., Macdonald G.A.,Prins J.B., Whitehead J.P.; Mol. Endocrinol. 20:1673-1687(2006). Cited for: SUBUNIT, HYDROXYLATION AT PRO-44; PRO-47; PRO-53; LYS-65; LYS-68;PRO-71; PRO-76; LYS-77; PRO-91; PRO-95 AND LYS-101, GLYCOSYLATION ATLYS-65; LYS-68; LYS-77 AND LYS-101, DISULFIDE BOND, LACK OFHYDROXYLATION AT PRO-62; PRO-86 AND PRO-104, LACK OF GLYCOSYLATION ATASN-230, MUTAGENESIS OF LYS-33; CYS-36; LYS-65; LYS-68; LYS-77 ANDLYS-101, AND MASS SPECTROMETRY. | |
| "Sialic acid modification of adiponectin is not required formultimerization or secretion but determines half-life incirculation."; Richards A.A., Colgrave M.L., Zhang J., Webster J., Simpson F.,Preston E., Wilks D., Hoehn K.L., Stephenson M., Macdonald G.A.,Prins J.B., Cooney G.J., Xu A., Whitehead J.P.; Mol. Endocrinol. 24:229-239(2010). Cited for: GLYCOSYLATION AT THR-21 AND THR-22, SUBUNIT, MASS SPECTROMETRY, ANDMUTAGENESIS OF THR-20; THR-21 AND THR-22. | |