ABEC1_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: ABEC1_HUMAN
• UniProt AC: P41238
• Protein Name: C->U-editing enzyme APOBEC-1
• Gene Name: APOBEC1
• Organism: Homo sapiens (Human).
• Sequence Length: 236
• Subcellular Localization: Cytoplasm .
• Protein Description: Catalytic component of the apolipoprotein B mRNA editing enzyme complex which is responsible for the postranscriptional editing of a CAA codon for Gln to a UAA codon for stop in the APOB mRNA. Also involved in CGA (Arg) to UGA (Stop) editing in the NF1 mRNA. May also play a role in the epigenetic regulation of gene expression by participating in DNA demethylation..
• Protein Sequence: MTSEKGPSTGDPTLRRRIEPWEFDVFYDPRELRKEACLLYEIKWGMSRKIWRSSGKNTTNHVEVNFIKKFTSERDFHPSMSCSITWFLSWSPCWECSQAIREFLSRHPGVTLVIYVARLFWHMDQQNRQGLRDLVNSGVTIQIMRASEYYHCWRNFVNYPPGDEAHWPQYPPLWMMLYALELHCIILSLPPCLKISRRWQNHLTFFRLHLQNCHYQTIPPHILLATGLIHPSVAWR

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
8	Phosphorylation	MTSEKGPSTGDPTLR CCCCCCCCCCCCCHH	54.41	27134283
13	Phosphorylation	GPSTGDPTLRRRIEP CCCCCCCCHHHHCCC	37.32	27134283
47	Phosphorylation	YEIKWGMSRKIWRSS HHHHHCCCHHHHHCC	26.87	22817900
53	Phosphorylation	MSRKIWRSSGKNTTN CCHHHHHCCCCCCCC	28.57	29978859
54	Phosphorylation	SRKIWRSSGKNTTNH CHHHHHCCCCCCCCC	45.25	29978859
58	Phosphorylation	WRSSGKNTTNHVEVN HHCCCCCCCCCEEEH	32.25	29978859
59	Phosphorylation	RSSGKNTTNHVEVNF HCCCCCCCCCEEEHH	32.49	29978859
72	Phosphorylation	NFIKKFTSERDFHPS HHHHHHCCCCCCCCC	33.49	22817900

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of ABEC1_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of ABEC1_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of ABEC1_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
BAG4_HUMAN	BAG4	physical	14559896
IMA1_HUMAN	KPNA2	physical	12881431
HNRPQ_HUMAN	SYNCRIP	physical	11352648
CELF2_CHICK	CELF2	physical	11577082
ABEC1_HUMAN	APOBEC1	physical	8999814

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.