UniProt ID | ABEC1_HUMAN | |
---|---|---|
UniProt AC | P41238 | |
Protein Name | C->U-editing enzyme APOBEC-1 | |
Gene Name | APOBEC1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 236 | |
Subcellular Localization | Cytoplasm . | |
Protein Description | Catalytic component of the apolipoprotein B mRNA editing enzyme complex which is responsible for the postranscriptional editing of a CAA codon for Gln to a UAA codon for stop in the APOB mRNA. Also involved in CGA (Arg) to UGA (Stop) editing in the NF1 mRNA. May also play a role in the epigenetic regulation of gene expression by participating in DNA demethylation.. | |
Protein Sequence | MTSEKGPSTGDPTLRRRIEPWEFDVFYDPRELRKEACLLYEIKWGMSRKIWRSSGKNTTNHVEVNFIKKFTSERDFHPSMSCSITWFLSWSPCWECSQAIREFLSRHPGVTLVIYVARLFWHMDQQNRQGLRDLVNSGVTIQIMRASEYYHCWRNFVNYPPGDEAHWPQYPPLWMMLYALELHCIILSLPPCLKISRRWQNHLTFFRLHLQNCHYQTIPPHILLATGLIHPSVAWR | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
8 | Phosphorylation | MTSEKGPSTGDPTLR CCCCCCCCCCCCCHH | 54.41 | 27134283 | |
13 | Phosphorylation | GPSTGDPTLRRRIEP CCCCCCCCHHHHCCC | 37.32 | 27134283 | |
47 | Phosphorylation | YEIKWGMSRKIWRSS HHHHHCCCHHHHHCC | 26.87 | 22817900 | |
53 | Phosphorylation | MSRKIWRSSGKNTTN CCHHHHHCCCCCCCC | 28.57 | 29978859 | |
54 | Phosphorylation | SRKIWRSSGKNTTNH CHHHHHCCCCCCCCC | 45.25 | 29978859 | |
58 | Phosphorylation | WRSSGKNTTNHVEVN HHCCCCCCCCCEEEH | 32.25 | 29978859 | |
59 | Phosphorylation | RSSGKNTTNHVEVNF HCCCCCCCCCEEEHH | 32.49 | 29978859 | |
72 | Phosphorylation | NFIKKFTSERDFHPS HHHHHHCCCCCCCCC | 33.49 | 22817900 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ABEC1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ABEC1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ABEC1_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
BAG4_HUMAN | BAG4 | physical | 14559896 | |
IMA1_HUMAN | KPNA2 | physical | 12881431 | |
HNRPQ_HUMAN | SYNCRIP | physical | 11352648 | |
CELF2_CHICK | CELF2 | physical | 11577082 | |
ABEC1_HUMAN | APOBEC1 | physical | 8999814 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...