| UniProt ID | 2ABB_ARATH | |
|---|---|---|
| UniProt AC | Q39247 | |
| Protein Name | Serine/threonine protein phosphatase 2A 55 kDa regulatory subunit B beta isoform | |
| Gene Name | PP2AB2 | |
| Organism | Arabidopsis thaliana (Mouse-ear cress). | |
| Sequence Length | 501 | |
| Subcellular Localization | ||
| Protein Description | The B regulatory subunit may modulate substrate selectivity and catalytic activity, and also may direct the localization of the catalytic enzyme to a particular subcellular compartment.. | |
| Protein Sequence | MNGGDDAATSGPPPSLEWRFSQVFGERTAGEEVQEVDIISAIEFDKSGDHLATGDRGGRVVLFERTDTKDHGGSRKDLEQTDYPVRHPEFRYKTEFQSHEPEFDYLKSLEIEEKINKIRWCQPANGALFLLSTNDKTIKYWKVQEKKIKKISEMNIDPSESSNIPPQLVTNGLPADKGHDYLSKDFSFPPGGIPSLRLPVVVTSQETNLVARCRRVYAHAHDYHINSISNSSDGETFISADDLRVNLWNLEISNQSFNIVDVKPTNMEDLTEVITSAEFHPIHCNMLAYSSSKGSIRLIDMRQSALCDSHTKLFEEPEAPGSRSFFTEIIASISDIKFSKDGRYILSRDYMTLKLWDINMDSGPVASYQVHEHLRPRLCDLYENDSIFDKFECCLSGDGLRVATGSYSNLFRVFGASQGSTEAATLEASKNPMRRQIQTPARPSRSIGSMTRVVRRGSESPGTEANGNAYDFTTKLLHMAWHPTENSIACAAANSLYMYYA | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 1 | Acetylation | -------MNGGDDAA -------CCCCCCCH | 10.70 | 22223895 | |
| 439 | Phosphorylation | PMRRQIQTPARPSRS CCHHHCCCCCCCCCC | 22.12 | 29654922 | |
| 446 | Phosphorylation | TPARPSRSIGSMTRV CCCCCCCCHHCCEEE | 35.32 | 28011693 | |
| 449 | Phosphorylation | RPSRSIGSMTRVVRR CCCCCHHCCEEEEEC | 18.47 | 29654922 | |
| 451 | Phosphorylation | SRSIGSMTRVVRRGS CCCHHCCEEEEECCC | 23.24 | 30407730 | |
| 458 | Phosphorylation | TRVVRRGSESPGTEA EEEEECCCCCCCCCC | 32.84 | 23776212 | |
| 460 | Phosphorylation | VVRRGSESPGTEANG EEECCCCCCCCCCCC | 30.26 | 30291188 | |
| 463 | Phosphorylation | RGSESPGTEANGNAY CCCCCCCCCCCCCEE | 35.00 | 23776212 | |
| 470 | Phosphorylation | TEANGNAYDFTTKLL CCCCCCEECHHHHHH | 18.65 | 23776212 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of 2ABB_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of 2ABB_ARATH !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of 2ABB_ARATH !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| RUXF_ARATH | RUXF | physical | 21798944 | |
| SRK2D_ARATH | SNRK2.2 | physical | 26175513 | |
| SRK2I_ARATH | SNRK2.3 | physical | 26175513 | |
| SRK2E_ARATH | OST1 | physical | 26175513 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
