UniProt ID | 2ABB_ARATH | |
---|---|---|
UniProt AC | Q39247 | |
Protein Name | Serine/threonine protein phosphatase 2A 55 kDa regulatory subunit B beta isoform | |
Gene Name | PP2AB2 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 501 | |
Subcellular Localization | ||
Protein Description | The B regulatory subunit may modulate substrate selectivity and catalytic activity, and also may direct the localization of the catalytic enzyme to a particular subcellular compartment.. | |
Protein Sequence | MNGGDDAATSGPPPSLEWRFSQVFGERTAGEEVQEVDIISAIEFDKSGDHLATGDRGGRVVLFERTDTKDHGGSRKDLEQTDYPVRHPEFRYKTEFQSHEPEFDYLKSLEIEEKINKIRWCQPANGALFLLSTNDKTIKYWKVQEKKIKKISEMNIDPSESSNIPPQLVTNGLPADKGHDYLSKDFSFPPGGIPSLRLPVVVTSQETNLVARCRRVYAHAHDYHINSISNSSDGETFISADDLRVNLWNLEISNQSFNIVDVKPTNMEDLTEVITSAEFHPIHCNMLAYSSSKGSIRLIDMRQSALCDSHTKLFEEPEAPGSRSFFTEIIASISDIKFSKDGRYILSRDYMTLKLWDINMDSGPVASYQVHEHLRPRLCDLYENDSIFDKFECCLSGDGLRVATGSYSNLFRVFGASQGSTEAATLEASKNPMRRQIQTPARPSRSIGSMTRVVRRGSESPGTEANGNAYDFTTKLLHMAWHPTENSIACAAANSLYMYYA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
1 | Acetylation | -------MNGGDDAA -------CCCCCCCH | 10.70 | 22223895 | |
439 | Phosphorylation | PMRRQIQTPARPSRS CCHHHCCCCCCCCCC | 22.12 | 29654922 | |
446 | Phosphorylation | TPARPSRSIGSMTRV CCCCCCCCHHCCEEE | 35.32 | 28011693 | |
449 | Phosphorylation | RPSRSIGSMTRVVRR CCCCCHHCCEEEEEC | 18.47 | 29654922 | |
451 | Phosphorylation | SRSIGSMTRVVRRGS CCCHHCCEEEEECCC | 23.24 | 30407730 | |
458 | Phosphorylation | TRVVRRGSESPGTEA EEEEECCCCCCCCCC | 32.84 | 23776212 | |
460 | Phosphorylation | VVRRGSESPGTEANG EEECCCCCCCCCCCC | 30.26 | 30291188 | |
463 | Phosphorylation | RGSESPGTEANGNAY CCCCCCCCCCCCCEE | 35.00 | 23776212 | |
470 | Phosphorylation | TEANGNAYDFTTKLL CCCCCCEECHHHHHH | 18.65 | 23776212 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of 2ABB_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of 2ABB_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of 2ABB_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
RUXF_ARATH | RUXF | physical | 21798944 | |
SRK2D_ARATH | SNRK2.2 | physical | 26175513 | |
SRK2I_ARATH | SNRK2.3 | physical | 26175513 | |
SRK2E_ARATH | OST1 | physical | 26175513 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...