UniProt ID | RUXF_ARATH | |
---|---|---|
UniProt AC | Q9SUM2 | |
Protein Name | Probable small nuclear ribonucleoprotein F | |
Gene Name | At4g30220 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 88 | |
Subcellular Localization | Nucleus. | |
Protein Description | Probable common Sm protein, is found in U1 and U2 snRNPs and may be part of the spliceosome.. | |
Protein Sequence | MATIPVNPKPFLNNLTGKTVIVKLKWGMEYKGFLASVDSYMNLQLGNTEEYIDGQLTGNLGEILIRCNNVLYVRGVPEDEELEDADQD | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
3 | Phosphorylation | -----MATIPVNPKP -----CCCCCCCCCC | 25.23 | 19880383 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RUXF_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RUXF_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RUXF_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
RUXF_ARATH | RUXF | physical | 21798944 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...