ZUC_DROME - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: ZUC_DROME
• UniProt AC: Q9VKD7
• Protein Name: Mitochondrial cardiolipin hydrolase
• Gene Name: zuc {ECO:0000303|PubMed:17543859, ECO:0000312|FlyBase:FBgn0261266}
• Organism: Drosophila melanogaster (Fruit fly).
• Sequence Length: 253
• Subcellular Localization: Mitochondrion outer membrane ; Single-pass membrane protein . Was initially reported to localize to the meiotic nuage, also named P granule (PubMed:17543859). However, it was later shown that the EGFP tag at N-terminus used in initial experiments int
• Protein Description: Cardiolipin hydrolase present at the mitochondrial outer membrane required for piRNA metabolic process. Acts by catalyzing the hydrolysis of cardiolipin (diphosphatidylglycerol) to form phosphatidate (phosphatidic acid or PA) at the mitochondrial outer membrane surface, promoting the piRNA metabolic process. Plays a key role in primary biogenesis of piRNAs and is required during oogenesis to repress transposable elements and prevent their mobilization. piRNAs mediate the repression of transposable elements during meiosis by forming complexes composed of piRNAs and Piwi proteins and govern the methylation and subsequent repression of transposons. Involved in trans-silencing effect (TSE), a homology-dependent repression mechanism by which a P-transgene inserted in subtelomeric heterochromatin via its role in piRNA biogenesis..
• Protein Sequence: MLITQIIMKQIRDYPIVSTISIAVSTVLASEVIWKLVQCSRSKREKASRVHEVIIFNELGEICAAVHMRNSSMGSQKPQVSPCCNTHCSLRNVAKIVEQIDRAVYSIDLAIYTFTSLFLADSIKRALQRGVIIRIISDGEMVYSKGSQISMLAQLGVPVRVPITTNLMHNKFCIIDGFERVEEIRLLRKLKFMRPCYSIVISGSVNWTALGLGGNWENCIITADDKLTATFQAEFQRMWRAFAKTEGSQIQLK

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of ZUC_DROME !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of ZUC_DROME !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of ZUC_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of ZUC_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
AGO3_DROME	AGO3	physical	25049272
PIWI_DROME	piwi	physical	20966049
ZUC_DROME	zuc	physical	26711011

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.