| UniProt ID | YMX1_CAEEL | |
|---|---|---|
| UniProt AC | P34509 | |
| Protein Name | Uncharacterized protein K06H7.1 | |
| Gene Name | K06H7.1 | |
| Organism | Caenorhabditis elegans. | |
| Sequence Length | 316 | |
| Subcellular Localization | ||
| Protein Description | ||
| Protein Sequence | MLQPNFRRFEPSYSWKSREKSTENRGFLSRMCGIKQKMNKYNCRGKYQETNDQNLMQDSGYSLKIISSGDEQITIVYTSRLGKMKDLQVPEIEISGVLLERLEACNYRLDELFIDLKASKCICSSNELLNIPKIIVRRLFLKMESLEMLEWWIERVDPNSLNELCIAPHGEYPLDIPSKIFDLPHFQNCKTLSIMEHCSFSTDQFLALCIAIPNFSFYSDRIDENIVAHAIKKRLSLNDQFVVLEWFFTKHVNVEKVTGDLKCTNYDRKERFDVKTECFEPVDVYSVPDENNKKTSLLVLKDSTDNFKPYNIVAFS | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
|---|---|---|---|---|---|---|
Oops, there are no PTM records of YMX1_CAEEL !! | ||||||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YMX1_CAEEL !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YMX1_CAEEL !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YMX1_CAEEL !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| CSN5_CAEEL | csn-5 | physical | 18692475 | |
| LIN41_CAEEL | lin-41 | physical | 18692475 | |
| CLH_CAEEL | chc-1 | physical | 18692475 | |
| TPM1_CAEEL | lev-11 | physical | 18692475 | |
| TPM3_CAEEL | lev-11 | physical | 18692475 | |
| EI2BA_CAEEL | ZK1098.4 | physical | 18692475 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...