dbPTM

YMX1_CAEEL - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	YMX1_CAEEL
UniProt AC	P34509
Protein Name	Uncharacterized protein K06H7.1
Gene Name	K06H7.1
Organism	Caenorhabditis elegans.
Sequence Length	316
Subcellular Localization
Protein Description
Protein Sequence	MLQPNFRRFEPSYSWKSREKSTENRGFLSRMCGIKQKMNKYNCRGKYQETNDQNLMQDSGYSLKIISSGDEQITIVYTSRLGKMKDLQVPEIEISGVLLERLEACNYRLDELFIDLKASKCICSSNELLNIPKIIVRRLFLKMESLEMLEWWIERVDPNSLNELCIAPHGEYPLDIPSKIFDLPHFQNCKTLSIMEHCSFSTDQFLALCIAIPNFSFYSDRIDENIVAHAIKKRLSLNDQFVVLEWFFTKHVNVEKVTGDLKCTNYDRKERFDVKTECFEPVDVYSVPDENNKKTSLLVLKDSTDNFKPYNIVAFS

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of YMX1_CAEEL !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of YMX1_CAEEL !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of YMX1_CAEEL !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of YMX1_CAEEL !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
CSN5_CAEEL	csn-5	physical	18692475
LIN41_CAEEL	lin-41	physical	18692475
CLH_CAEEL	chc-1	physical	18692475
TPM1_CAEEL	lev-11	physical	18692475
TPM3_CAEEL	lev-11	physical	18692475
EI2BA_CAEEL	ZK1098.4	physical	18692475

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of YMX1_CAEEL

Related Literatures of Post-Translational Modification