dbPTM

YIDE_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	YIDE_SCHPO
UniProt AC	Q9UTC5
Protein Name	Putative uridine kinase C227.14
Gene Name	SPAC227.14
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	235
Subcellular Localization	Cytoplasm . Nucleus .
Protein Description
Protein Sequence	MALQVDAPDVSSYDELYNRAVELLKHQQRVLIGLAGGPGSGKSTLCAILAKAWNERFGSEIVKIIPMDGFHYSLEELDRFDNPEKARALRGAEWTFDADLFYSLVRLMKKITDRELYAPSFDHAIGDPVVDDICVEPKNRILIFEGNYLLLNKPPWSDACKLYDIKAYLPVEHSVARARVAHRHLVSGLCATEEEAIERTDRNDMINLTFVEKNMVTPDIVLQQLRLKTVKTSSL

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of YIDE_SCHPO !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of YIDE_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of YIDE_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of YIDE_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
NTH_SCHPO	nth1	genetic	18818364
AMO1_SCHPO	amo1	genetic	18818364
HPC2_SCHPO	hip4	genetic	18818364
YCJD_SCHPO	SPCC63.13	genetic	22681890
YNVD_SCHPO	far10	genetic	22681890
COX8_SCHPO	cox8	genetic	22681890
GSHB_SCHPO	gsa1	genetic	22681890
ALF1_SCHPO	alf1	genetic	22681890
ZFS1_SCHPO	zfs1	genetic	22681890
YF89_SCHPO	SPAC27D7.09c	genetic	22681890

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of YIDE_SCHPO

Related Literatures of Post-Translational Modification