UniProt ID | YIDE_SCHPO | |
---|---|---|
UniProt AC | Q9UTC5 | |
Protein Name | Putative uridine kinase C227.14 | |
Gene Name | SPAC227.14 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 235 | |
Subcellular Localization | Cytoplasm . Nucleus . | |
Protein Description | ||
Protein Sequence | MALQVDAPDVSSYDELYNRAVELLKHQQRVLIGLAGGPGSGKSTLCAILAKAWNERFGSEIVKIIPMDGFHYSLEELDRFDNPEKARALRGAEWTFDADLFYSLVRLMKKITDRELYAPSFDHAIGDPVVDDICVEPKNRILIFEGNYLLLNKPPWSDACKLYDIKAYLPVEHSVARARVAHRHLVSGLCATEEEAIERTDRNDMINLTFVEKNMVTPDIVLQQLRLKTVKTSSL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of YIDE_SCHPO !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YIDE_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YIDE_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YIDE_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
NTH_SCHPO | nth1 | genetic | 18818364 | |
AMO1_SCHPO | amo1 | genetic | 18818364 | |
HPC2_SCHPO | hip4 | genetic | 18818364 | |
YCJD_SCHPO | SPCC63.13 | genetic | 22681890 | |
YNVD_SCHPO | far10 | genetic | 22681890 | |
COX8_SCHPO | cox8 | genetic | 22681890 | |
GSHB_SCHPO | gsa1 | genetic | 22681890 | |
ALF1_SCHPO | alf1 | genetic | 22681890 | |
ZFS1_SCHPO | zfs1 | genetic | 22681890 | |
YF89_SCHPO | SPAC27D7.09c | genetic | 22681890 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...