YH175_YEAST - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: YH175_YEAST
• UniProt AC: Q3E815
• Protein Name: Uncharacterized membrane protein YHR175W-A
• Gene Name: YHR175W-A
• Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
• Sequence Length: 49
• Subcellular Localization: Membrane ; Single-pass membrane protein .
• Protein Sequence: MINYVNITCIIFSTRTLLVFDTSLYIPPFMLSFIGYSLSNQNSPLFLYH

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
4	Phosphorylation	----MINYVNITCII ----CCCEECEEEEE	5.50	28132839

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of YH175_YEAST !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of YH175_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of YH175_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
MCM1_YEAST	MCM1	genetic	27708008
SCC1_YEAST	MCD1	genetic	27708008
TECR_YEAST	TSC13	genetic	27708008
TEL2_YEAST	TEL2	genetic	27708008
GSH1_YEAST	GSH1	genetic	27708008

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.