UniProt ID | YG0G_SCHPO | |
---|---|---|
UniProt AC | O94728 | |
Protein Name | Uncharacterized protein C1604.16c | |
Gene Name | SPBC1604.16c | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 199 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MENKGNMELSNSYGFYKNGRRVSFVKATSEQSLDEATFIEKGSAQAFYHSLFENDRDNSHTMNSKRDEAGFACEVCQIYIPNSKKINHFKSMTHLLSSQHISNKFQPHLLKPKSLGYRVLSQYGWSPQGDTAGLGLENQGRRAPVRAFRVKNDTIGLGTKIDLEKVAVNKCRKGKRQCQIQHSKDVRLKEALIKHFSSN | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of YG0G_SCHPO !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YG0G_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YG0G_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YG0G_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
TIM21_SCHPO | tim21 | genetic | 22681890 | |
CAO2_SCHPO | cao2 | genetic | 22681890 | |
YJ53_SCHPO | SPCC4F11.03c | genetic | 22681890 | |
ASK1_SCHPO | ask1 | genetic | 22681890 | |
FFT3_SCHPO | fft3 | genetic | 22681890 | |
DAD2_SCHPO | dad2 | genetic | 22681890 | |
IWR1_SCHPO | iwr1 | genetic | 22681890 | |
YFFL_SCHPO | SPAC1687.21 | genetic | 22681890 | |
UBP2_SCHPO | ubp2 | genetic | 22681890 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...