YAKA_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: YAKA_SCHPO
• UniProt AC: Q09921
• Protein Name: Uncharacterized protein C1F7.10
• Gene Name: SPAC1F7.10
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 238
• Protein Sequence: MIRILVINPNSTVQMTESVKSVLDDCTPPNVQLEYLTCPPEGPKAIECVSDGVRSAAVLMKYFEDHPPQVDAFLVSCYSDHPLVTTLRETYRKPCTGIMQASILTALSLGRKVSVVTTTKRYEPLLTDGIHAMGISDSVFAGIASTGLAPLELDSKPRAEVDALLARTALRAVNEMGADVICLGCAGMTHMAHVLEKAVGPNIPIIDGTKAGVELLASLVRMNLFTSKQGVYQAVGSD

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
237	Phosphorylation	GVYQAVGSD------ CHHHHCCCC------	33.28	25720772

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of YAKA_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of YAKA_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of YAKA_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
YAKA_SCHPO	SPAC1F7.10	physical	26771498
TFS2_SCHPO	tfs1	physical	26771498
RCD1_SCHPO	rcd1	physical	26771498
YF75_SCHPO	spa2	physical	26771498
IMA2_SCHPO	imp1	physical	26771498
YQE2_SCHPO	SPCC576.02	physical	26771498

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.