UniProt ID | XAGE1_HUMAN | |
---|---|---|
UniProt AC | Q9HD64 | |
Protein Name | X antigen family member 1 | |
Gene Name | XAGE1A | |
Organism | Homo sapiens (Human). | |
Sequence Length | 81 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MESPKKKNQQLKVGILHLGSRQKKIRIQLRSQCATWKVICKSCISQTPGINLDLGSGVKVKIIPKEEHCKMPEAGEEQPQV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
6 | Ubiquitination | --MESPKKKNQQLKV --CCCCCHHHCCCEE | 23000965 | ||
7 | Ubiquitination | -MESPKKKNQQLKVG -CCCCCHHHCCCEEE | 23000965 | ||
12 | Sumoylation | KKKNQQLKVGILHLG CHHHCCCEEEEEECC | 28112733 | ||
12 | Ubiquitination | KKKNQQLKVGILHLG CHHHCCCEEEEEECC | 23000965 | ||
20 | Phosphorylation | VGILHLGSRQKKIRI EEEEECCCCCCEEEE | 28112733 | ||
37 | Ubiquitination | RSQCATWKVICKSCI HHHHCHHHHHHHHHH | 23000965 | ||
41 | Ubiquitination | ATWKVICKSCISQTP CHHHHHHHHHHHCCC | 23000965 | ||
59 | Ubiquitination | LDLGSGVKVKIIPKE EECCCCCEEEECCHH | - | ||
61 | Ubiquitination | LGSGVKVKIIPKEEH CCCCCEEEECCHHHH | - | ||
61 | Sumoylation | LGSGVKVKIIPKEEH CCCCCEEEECCHHHH | 28112733 | ||
65 | Sumoylation | VKVKIIPKEEHCKMP CEEEECCHHHHCCCC | 28112733 | ||
70 | Ubiquitination | IPKEEHCKMPEAGEE CCHHHHCCCCCCCCC | - | ||
71 | Ubiquitination | PKEEHCKMPEAGEEQ CHHHHCCCCCCCCCC | 23000965 | ||
72 | Ubiquitination | KEEHCKMPEAGEEQP HHHHCCCCCCCCCCC | 23000965 | ||
77 | Ubiquitination | KMPEAGEEQPQV--- CCCCCCCCCCCC--- | 23000965 | ||
85 | Ubiquitination | QPQV----------- CCCC----------- | 23000965 | ||
86 | Ubiquitination | PQV------------ CCC------------ | 23000965 | ||
91 | Ubiquitination | ----------------- ----------------- | 23000965 | ||
102 | Ubiquitination | ---------------------------- ---------------------------- | 23000965 | ||
106 | Ubiquitination | -------------------------------- -------------------------------- | 23000965 | ||
106 (in isoform 2) | Ubiquitination | - | 21906983 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of XAGE1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of XAGE1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of XAGE1_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
YAF2_HUMAN | YAF2 | physical | 25416956 | |
SETBP_HUMAN | SETBP1 | physical | 25416956 | |
BANP_HUMAN | BANP | physical | 25416956 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...