| UniProt ID | WNT7B_MOUSE | |
|---|---|---|
| UniProt AC | P28047 | |
| Protein Name | Protein Wnt-7b | |
| Gene Name | Wnt7b | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 349 | |
| Subcellular Localization | Secreted, extracellular space, extracellular matrix . Secreted . | |
| Protein Description | Ligand for members of the frizzled family of seven transmembrane receptors. [PubMed: 15923619 Functions in the canonical Wnt/beta-catenin signaling pathway in vascular smooth muscle cells] | |
| Protein Sequence | MHRNFRKWIFYVFLCFGVLYVKLGALSSVVALGANIICNKIPGLAPRQRAICQSRPDAIIVIGEGAQMGIDECQHQFRFGRWNCSALGEKTVFGQELRVGSREAAFTYAITAAGVAHAVTAACSQGNLSNCGCDREKQGYYNQAEGWKWGGCSADVRYGIDFSRRFVDAREIKKNARRLMNLHNNEAGRKVLEDRMKLECKCHGVSGSCTTKTCWTTLPKFREVGHLLKEKYNAAVQVEVVRASRLRQPTFLRIKQLRSYQKPMETDLVYIEKSPNYCEEDAATGSVGTQGRLCNRTSPGADGCDTMCCGRGYNTHQYTKVWQCNCKFHWCCFVKCNTCSERTEVFTCK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 83 | N-linked_Glycosylation | QFRFGRWNCSALGEK HHHCCCCCCHHCCCC | 14.43 | - | |
| 91 | Phosphorylation | CSALGEKTVFGQELR CHHCCCCEEECEEEE | 19.43 | 24719451 | |
| 127 | N-linked_Glycosylation | TAACSQGNLSNCGCD HHHHHCCCHHHCCCC | 32.43 | - | |
| 206 | O-palmitoleoylation | ECKCHGVSGSCTTKT EEEEECCCCCCCCCC | 29.58 | - | |
| 295 | N-linked_Glycosylation | GTQGRLCNRTSPGAD CCCCCCCCCCCCCCC | 55.65 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of WNT7B_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of WNT7B_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of WNT7B_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| LRP5_MOUSE | Lrp5 | genetic | 15923619 | |
| FZD1_MOUSE | Fzd1 | genetic | 15923619 | |
| FZD10_MOUSE | Fzd10 | genetic | 15923619 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
