UniProt ID | WNT7B_MOUSE | |
---|---|---|
UniProt AC | P28047 | |
Protein Name | Protein Wnt-7b | |
Gene Name | Wnt7b | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 349 | |
Subcellular Localization | Secreted, extracellular space, extracellular matrix . Secreted . | |
Protein Description | Ligand for members of the frizzled family of seven transmembrane receptors. [PubMed: 15923619 Functions in the canonical Wnt/beta-catenin signaling pathway in vascular smooth muscle cells] | |
Protein Sequence | MHRNFRKWIFYVFLCFGVLYVKLGALSSVVALGANIICNKIPGLAPRQRAICQSRPDAIIVIGEGAQMGIDECQHQFRFGRWNCSALGEKTVFGQELRVGSREAAFTYAITAAGVAHAVTAACSQGNLSNCGCDREKQGYYNQAEGWKWGGCSADVRYGIDFSRRFVDAREIKKNARRLMNLHNNEAGRKVLEDRMKLECKCHGVSGSCTTKTCWTTLPKFREVGHLLKEKYNAAVQVEVVRASRLRQPTFLRIKQLRSYQKPMETDLVYIEKSPNYCEEDAATGSVGTQGRLCNRTSPGADGCDTMCCGRGYNTHQYTKVWQCNCKFHWCCFVKCNTCSERTEVFTCK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
83 | N-linked_Glycosylation | QFRFGRWNCSALGEK HHHCCCCCCHHCCCC | 14.43 | - | |
91 | Phosphorylation | CSALGEKTVFGQELR CHHCCCCEEECEEEE | 19.43 | 24719451 | |
127 | N-linked_Glycosylation | TAACSQGNLSNCGCD HHHHHCCCHHHCCCC | 32.43 | - | |
206 | O-palmitoleoylation | ECKCHGVSGSCTTKT EEEEECCCCCCCCCC | 29.58 | - | |
295 | N-linked_Glycosylation | GTQGRLCNRTSPGAD CCCCCCCCCCCCCCC | 55.65 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of WNT7B_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of WNT7B_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of WNT7B_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
LRP5_MOUSE | Lrp5 | genetic | 15923619 | |
FZD1_MOUSE | Fzd1 | genetic | 15923619 | |
FZD10_MOUSE | Fzd10 | genetic | 15923619 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...