dbPTM

VFLIP_HHV8P - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	VFLIP_HHV8P
UniProt AC	F5HEZ4
Protein Name	Viral FLICE protein
Gene Name	ORF71
Organism	Human herpesvirus 8 type P (isolate GK18) (HHV-8) (Kaposi's sarcoma-associated herpesvirus).
Sequence Length	188
Subcellular Localization
Protein Description	Plays a role in the modulation of host signaling pathways by acting as an activator of both the classic and the alternative NF-kappa-B pathways. Thereby, initiates an important range of cellular processes to promote cell survival, proliferation and protection from apoptosis..
Protein Sequence	MATYEVLCEVARKLGTDDREVVLFLLNVFIPQPTLAQLIGALRALKEEGRLTFPLLAECLFRAGRRDLLRDLLHLDPRFLERHLAGTMSYFSPYQLTVLHVDGELCARDIRSLIFLSKDTIGSRSTPQTFLHWVYCMENLDLLGPTDVDALMSMLRSLSRVDLQRQVQTLMGLHLSGPSHSQHYRHTP

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of VFLIP_HHV8P !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
-	K	Ubiquitination	E3 ubiquitin ligase	ITCH	Q96J02	PMID:27912080

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of VFLIP_HHV8P !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of VFLIP_HHV8P !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
M3K7_HUMAN	MAP3K7	physical	21159881
TRAF2_HUMAN	TRAF2	physical	22525270
NEMO_HUMAN	IKBKG	physical	22525270
TRAF2_HUMAN	TRAF2	physical	16311516
NEMO_HUMAN	IKBKG	physical	11830587
RIPK1_HUMAN	RIPK1	physical	11830587
IKKA_HUMAN	CHUK	physical	11830587
IKKB_HUMAN	IKBKB	physical	11830587
IKBA_HUMAN	NFKBIA	physical	11830587
NEMO_HUMAN	IKBKG	physical	24672029
NEMO_HUMAN	IKBKG	physical	26865630
ITCH_HUMAN	ITCH	physical	27912080
IKKB_HUMAN	IKBKB	physical	25544563
IKKA_HUMAN	CHUK	physical	25544563
NEMO_HUMAN	IKBKG	physical	25544563
CDC37_HUMAN	CDC37	physical	25544563

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of VFLIP_HHV8P

Related Literatures of Post-Translational Modification