UniProt ID | VFLIP_HHV8P | |
---|---|---|
UniProt AC | F5HEZ4 | |
Protein Name | Viral FLICE protein | |
Gene Name | ORF71 | |
Organism | Human herpesvirus 8 type P (isolate GK18) (HHV-8) (Kaposi's sarcoma-associated herpesvirus). | |
Sequence Length | 188 | |
Subcellular Localization | ||
Protein Description | Plays a role in the modulation of host signaling pathways by acting as an activator of both the classic and the alternative NF-kappa-B pathways. Thereby, initiates an important range of cellular processes to promote cell survival, proliferation and protection from apoptosis.. | |
Protein Sequence | MATYEVLCEVARKLGTDDREVVLFLLNVFIPQPTLAQLIGALRALKEEGRLTFPLLAECLFRAGRRDLLRDLLHLDPRFLERHLAGTMSYFSPYQLTVLHVDGELCARDIRSLIFLSKDTIGSRSTPQTFLHWVYCMENLDLLGPTDVDALMSMLRSLSRVDLQRQVQTLMGLHLSGPSHSQHYRHTP | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of VFLIP_HHV8P !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of VFLIP_HHV8P !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of VFLIP_HHV8P !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
M3K7_HUMAN | MAP3K7 | physical | 21159881 | |
TRAF2_HUMAN | TRAF2 | physical | 22525270 | |
NEMO_HUMAN | IKBKG | physical | 22525270 | |
TRAF2_HUMAN | TRAF2 | physical | 16311516 | |
NEMO_HUMAN | IKBKG | physical | 11830587 | |
RIPK1_HUMAN | RIPK1 | physical | 11830587 | |
IKKA_HUMAN | CHUK | physical | 11830587 | |
IKKB_HUMAN | IKBKB | physical | 11830587 | |
IKBA_HUMAN | NFKBIA | physical | 11830587 | |
NEMO_HUMAN | IKBKG | physical | 24672029 | |
NEMO_HUMAN | IKBKG | physical | 26865630 | |
ITCH_HUMAN | ITCH | physical | 27912080 | |
IKKB_HUMAN | IKBKB | physical | 25544563 | |
IKKA_HUMAN | CHUK | physical | 25544563 | |
NEMO_HUMAN | IKBKG | physical | 25544563 | |
CDC37_HUMAN | CDC37 | physical | 25544563 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...