USE1_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: USE1_MOUSE
• UniProt AC: Q9CQ56
• Protein Name: Vesicle transport protein USE1
• Gene Name: Use1
• Organism: Mus musculus (Mouse).
• Sequence Length: 270
• Subcellular Localization: Endoplasmic reticulum membrane; Single-pass type IV membrane protein.
• Protein Description: SNARE that may be involved in targeting and fusion of Golgi-derived retrograde transport vesicles with the ER..
• Protein Sequence: MAQAEGAYHRPLATSRLELNLVRLLCRCESMAAEKREPDEWRLEKYVGALEDMLQALKVQASKPASEVISEYSRKVDFLKGMLQAEKLTSSSEKALANQFLAPGRVPTTAKERVPATKTVHLQSRARYTSEMRSELLGMEPSGECEVDMRKRAAKGSRPADERQSASELDLVLQRHQGLQEKLAEEMLGLARSLKTNTLAAQSVIKKDNQTLSHSLKMADQNLEKLKLESERLEQHAQKSVNWLLWAMLIVVCFVFISMILFIRIMPRLK

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
8	Phosphorylation	MAQAEGAYHRPLATS CCCCCCCCCCCCCCC	14.82	29514104
70	Phosphorylation	KPASEVISEYSRKVD CCHHHHHHHHHHHHH	35.34	28576409
72	Phosphorylation	ASEVISEYSRKVDFL HHHHHHHHHHHHHHH	13.64	28576409
94	Ubiquitination	KLTSSSEKALANQFL HCCCHHHHHHHHHCC	51.12	-
108	Phosphorylation	LAPGRVPTTAKERVP CCCCCCCCCHHHCCC	36.21	28059163
165	Phosphorylation	RPADERQSASELDLV CCHHHHHCHHHHHHH	39.73	25521595
167	Phosphorylation	ADERQSASELDLVLQ HHHHHCHHHHHHHHH	43.89	27180971
203	Phosphorylation	TNTLAAQSVIKKDNQ HCHHHHHHHHHHCCC	22.53	29176673
213	Phosphorylation	KKDNQTLSHSLKMAD HHCCCCHHHHHHHHH	17.89	29176673
215	Phosphorylation	DNQTLSHSLKMADQN CCCCHHHHHHHHHHH	26.72	25521595

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of USE1_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of USE1_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of USE1_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
UBR1_MOUSE	Ubr1	physical	21816346
UBR2_MOUSE	Ubr2	physical	21816346

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.