URM1_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: URM1_HUMAN
• UniProt AC: Q9BTM9
• Protein Name: Ubiquitin-related modifier 1 {ECO:0000255|HAMAP-Rule:MF_03048}
• Gene Name: URM1 {ECO:0000255|HAMAP-Rule:MF_03048}
• Organism: Homo sapiens (Human).
• Sequence Length: 101
• Subcellular Localization: Cytoplasm.
• Protein Description: Acts as a sulfur carrier required for 2-thiolation of mcm(5)S(2)U at tRNA wobble positions of cytosolic tRNA(Lys), tRNA(Glu) and tRNA(Gln). Serves as sulfur donor in tRNA 2-thiolation reaction by being thiocarboxylated (-COSH) at its C-terminus by MOCS3. The sulfur is then transferred to tRNA to form 2-thiolation of mcm(5)S(2)U. Also acts as a ubiquitin-like protein (UBL) that is covalently conjugated via an isopeptide bond to lysine residues of target proteins such as MOCS3, ATPBD3, CTU2, USP15 and CAS. The thiocarboxylated form serves as substrate for conjugation and oxidative stress specifically induces the formation of UBL-protein conjugates..
• Protein Sequence: MAAPLSVEVEFGGGAELLFDGIKKHRVTLPGQEEPWDIRNLLIWIKKNLLKERPELFIQGDSVRPGILVLINDADWELLGELDYQLQDQDSVLFISTLHGG

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
101	1-thioglycine	FISTLHGG------- EEEECCCC-------	24.49	-
101	Thiocarboxylation	FISTLHGG------- EEEECCCC-------	24.49	19017811
103 (in isoform 2)	Phosphorylation	-		-
121 (in isoform 2)	Phosphorylation	-		-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of URM1_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of URM1_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of URM1_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
CTU1_HUMAN	CTU1	physical	19017811
VINC_HUMAN	VCL	physical	22939629
XPO1_HUMAN	XPO1	physical	22939629
VATA_HUMAN	ATP6V1A	physical	22939629
GDPP1_HUMAN	GDPGP1	physical	26344197

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.