dbPTM

UN119_DROME - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	UN119_DROME
UniProt AC	Q9XYQ2
Protein Name	Protein unc-119 homolog
Gene Name	unc-119
Organism	Drosophila melanogaster (Fruit fly).
Sequence Length	265
Subcellular Localization
Protein Description	Myristoyl-binding protein that acts as a cargo adapter: specifically binds the myristoyl moiety of a subset of N-terminally myristoylated proteins and is required for their localization..
Protein Sequence	MSVVGKQLNPVQSSGAGAVTTSSSAAAGSSSSNSGVEANGGSGGSSGAAAAGAGASGDAKRPAESSSVTPDEVLHLTKITDDYLCSANANVFEIDFTRFKIRDLESGAVLFEIAKPPSEQYPEGLSSDETMLAAAEKLSLDDTADPNAGRYVRYQFTPAFLNLKTVGATVEFTVGSQPLNNFRMIERHFFRDRLLKTFDFEFGFCFPFSKNTVEHIYEFPNLPPDLVAEMISSPFETRSDSFYFVGNRLVMHNKADYAYDGGNIV

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of UN119_DROME !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of UN119_DROME !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of UN119_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of UN119_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
PORED_DROME	CG7840	physical	14605208
G3P2_DROME	Gapdh2	physical	14605208

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of UN119_DROME

Related Literatures of Post-Translational Modification