UniProt ID | UN119_DROME | |
---|---|---|
UniProt AC | Q9XYQ2 | |
Protein Name | Protein unc-119 homolog | |
Gene Name | unc-119 | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 265 | |
Subcellular Localization | ||
Protein Description | Myristoyl-binding protein that acts as a cargo adapter: specifically binds the myristoyl moiety of a subset of N-terminally myristoylated proteins and is required for their localization.. | |
Protein Sequence | MSVVGKQLNPVQSSGAGAVTTSSSAAAGSSSSNSGVEANGGSGGSSGAAAAGAGASGDAKRPAESSSVTPDEVLHLTKITDDYLCSANANVFEIDFTRFKIRDLESGAVLFEIAKPPSEQYPEGLSSDETMLAAAEKLSLDDTADPNAGRYVRYQFTPAFLNLKTVGATVEFTVGSQPLNNFRMIERHFFRDRLLKTFDFEFGFCFPFSKNTVEHIYEFPNLPPDLVAEMISSPFETRSDSFYFVGNRLVMHNKADYAYDGGNIV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of UN119_DROME !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of UN119_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of UN119_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of UN119_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
PORED_DROME | CG7840 | physical | 14605208 | |
G3P2_DROME | Gapdh2 | physical | 14605208 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...