UN119_DROME - dbPTM
UN119_DROME - PTM Information in dbPTM
Basic Information of Protein
UniProt ID UN119_DROME
UniProt AC Q9XYQ2
Protein Name Protein unc-119 homolog
Gene Name unc-119
Organism Drosophila melanogaster (Fruit fly).
Sequence Length 265
Subcellular Localization
Protein Description Myristoyl-binding protein that acts as a cargo adapter: specifically binds the myristoyl moiety of a subset of N-terminally myristoylated proteins and is required for their localization..
Protein Sequence MSVVGKQLNPVQSSGAGAVTTSSSAAAGSSSSNSGVEANGGSGGSSGAAAAGAGASGDAKRPAESSSVTPDEVLHLTKITDDYLCSANANVFEIDFTRFKIRDLESGAVLFEIAKPPSEQYPEGLSSDETMLAAAEKLSLDDTADPNAGRYVRYQFTPAFLNLKTVGATVEFTVGSQPLNNFRMIERHFFRDRLLKTFDFEFGFCFPFSKNTVEHIYEFPNLPPDLVAEMISSPFETRSDSFYFVGNRLVMHNKADYAYDGGNIV
Overview of Protein Modification Sites with Functional and Structural Information
Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations Modification Substrate Peptides
&
Secondary Structure
ASA (%) Reference Orthologous
Protein Cluster

Oops, there are no PTM records of UN119_DROME !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)
Modified Location Modified Residue Modification Type of Upstream Proteins Gene Name of Upstream Proteins UniProt AC of Upstream Proteins Sources

Oops, there are no upstream regulatory protein records of UN119_DROME !!

Functions of PTM Sites
Modified Location Modified Residue Modification Function Reference

Oops, there are no descriptions of PTM sites of UN119_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location Modification Variant Position
(Distance <= 10)
Residue Change SAP Related Disease Reference

Oops, there are no SNP-PTM records of UN119_DROME !!

Protein-Protein Interaction
Interacting Protein Gene Name Interaction Type PPI Reference Domain-Domain Interactions
PORED_DROMECG7840physical
14605208
G3P2_DROMEGapdh2physical
14605208

Drug and Disease Associations
Kegg Drug
DrugBank
There are no disease associations of PTM sites.
Regulatory Network of UN119_DROME

loading...

Related Literatures of Post-Translational Modification

TOP